CD30L protein(N-His)(active) (recombinant human)

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
E-PKSH034123.20	20 µg		-		7 - 16 business days*		241.00€
E-PKSH034123.100	100 µg		-		7 - 16 business days*		632.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Activity: Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this... more

Close menu

Product information "CD30L protein(N-His)(active) (recombinant human)"

Activity: Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <2 ng/mL. Sequence: MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD. Fusion tag: N-His Endotoxin: <0.01 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. [The UniProt Consortium]

Keywords:	CD153, CD30L, TNFSF8, CD30-L, CD30 ligand, Tumor necrosis factor ligand superfamily member 8, Recombinant Human CD30L protein(N-His)(active)
Supplier:	Elabscience
Supplier-Nr:	E-PKSH034123

Properties

Application:	Active, cell culture
Conjugate:	No
Host:	E.coli
Species reactivity:	human
MW:	26.85 kD
Format:	Lyophilized

Database Information

KEGG ID :	K05471 \| Matching products
UniProt ID :	P32971 \| Matching products
Gene ID :	GeneID 944 \| Matching products

Handling & Safety

Storage:	-80°C
Shipping:	+4°C (International: -20°C)

Caution
Our products are for laboratory research use only: Not for administration to humans!

Information about the product reference will follow. more

Close menu

View product citations for antibody E-PKSH034123 on CiteAb

You will get a certificate here

Go back

Read, write and discuss reviews... more

Close menu

Customer review for "CD30L protein(N-His)(active) (recombinant human)"

Write a review