Beta Defensin 2, Human, aa4-41 (Beta-Defensin 2, beta 2, BD-2, Skin-Antimicrobial Peptide, SAP1)

Beta Defensin 2, Human, aa4-41 (Beta-Defensin 2, beta 2, BD-2, Skin-Antimicrobial Peptide, SAP1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298122.100 100 µg - -

3 - 19 business days*

780.00€
 
Has antibacterial activity.||Source:|Synthetic human Beta Defensin 2||AA... more
Product information "Beta Defensin 2, Human, aa4-41 (Beta-Defensin 2, beta 2, BD-2, Skin-Antimicrobial Peptide, SAP1)"
Has antibacterial activity. Source: Synthetic human Beta Defensin 2, AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: SAP1, BD-2, hBD-2, DEFB4A, DEFB4B, DEFB102, Beta-defensin 2, Beta-defensin 4A, Defensin, beta 2, Skin-antimicrobial peptide 1
Supplier: United States Biological
Supplier-Nr: 298122

Properties

Conjugate: No
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Beta Defensin 2, Human, aa4-41 (Beta-Defensin 2, beta 2, BD-2, Skin-Antimicrobial Peptide, SAP1)"
Write a review
or to review a product.
Viewed