Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against... read more »
Close window
Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Filter
13033 from 13202 pages
No results were found for the filter!
SERPINB2 PrEST Antigen
SERPINB2 PrEST Antigen

Item number: ATA-APrEST95710.100

Atlas Antibodies
PrEST Antigen SERPINB2, Gene description: serpin family B member 2, Alternative Gene Names: HsT1201, PAI-2, PAI2, PLANH2, Antigen sequence: DEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Inhibits...
Keywords: PAI2, PAI-2, SERPINB2, Serpin B2, Urokinase inhibitor, Monocyte Arg-serpin, Plasminogen activator inhibitor 2, Placental...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
PPP3CC PrEST Antigen
PPP3CC PrEST Antigen

Item number: ATA-APrEST95711.100

Atlas Antibodies
PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent,...
Keywords: PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
LRRC18 PrEST Antigen
LRRC18 PrEST Antigen

Item number: ATA-APrEST95713.100

Atlas Antibodies
PrEST Antigen LRRC18, Gene description: leucine rich repeat containing 18, Alternative Gene Names: MGC34773, UNQ933, UNQ9338, VKGE9338, Antigen sequence: PVELKQLKNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: LRRC18, Leucine-rich repeat-containing protein 18
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CIDEB PrEST Antigen
CIDEB PrEST Antigen

Item number: ATA-APrEST95715.100

Atlas Antibodies
PrEST Antigen CIDEB, Gene description: cell death inducing DFFA like effector b, Antigen sequence: TAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Activates apoptosis. [The UniProt Consortium] Mouse...
Keywords: CIDEB, Cell death activator CIDE-B, Cell death-inducing DFFA-like effector B
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
MOGAT1 PrEST Antigen
MOGAT1 PrEST Antigen

Item number: ATA-APrEST95719.100

Atlas Antibodies
PrEST Antigen MOGAT1, Gene description: monoacylglycerol O-acyltransferase 1, Alternative Gene Names: DGAT2L, DGAT2L1, MGAT1, Antigen sequence: GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the...
Keywords: DC2, hDC2, MGAT1, 2-acylglycerol O-acyltransferase 1, Monoacylglycerol O-acyltransferase 1, Acyl-CoA:monoacylglycerol...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
GOT2 PrEST Antigen
GOT2 PrEST Antigen

Item number: ATA-APrEST95720.100

Atlas Antibodies
PrEST Antigen GOT2, Gene description: glutamic-oxaloacetic transaminase 2, Alternative Gene Names: KAT4, KATIV, KYAT4, mitAAT, Antigen sequence: FKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the...
Keywords: FABP-1, mAspAT, FABPpm, Transaminase A, Fatty acid-binding protein, Kynurenine aminotransferase 4, Kynurenine...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
IRX3 PrEST Antigen
IRX3 PrEST Antigen

Item number: ATA-APrEST95721.100

Atlas Antibodies
PrEST Antigen IRX3, Gene description: iroquois homeobox 3, Alternative Gene Names: IRX-1, Antigen sequence: GEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcription factor involved in SHH-dependent neural...
Keywords: IRX3, IRXB1, Homeodomain protein IRXB1, Iroquois homeobox protein 3, Iroquois-class homeodomain protein IRX-3
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
DLC1 PrEST Antigen
DLC1 PrEST Antigen

Item number: ATA-APrEST95722.100

Atlas Antibodies
PrEST Antigen DLC1, Gene description: DLC1 Rho GTPase activating protein, Alternative Gene Names: ARHGAP7, DLC-1, HP, p122-RhoGAP, STARD12, Antigen sequence: MVLLIMKLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTESTDLPSSTPVANSGTKPKTTAIQGI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: DLC1, DLC-1, ARHGAP7, StARD12, HP protein, Rho GTPase-activating protein 7, Deleted in liver cancer 1 protein, START...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
BST2 PrEST Antigen
BST2 PrEST Antigen

Item number: ATA-APrEST95723.100

Atlas Antibodies
PrEST Antigen BST2, Gene description: bone marrow stromal cell antigen 2, Alternative Gene Names: BST-2, CD317, HM1.24, tetherin, Antigen sequence: FTIKANSEACRDGLRAVMECRNVT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: IFN-induced antiviral host restriction factor which...
Keywords: BST2, BST-2, CD317, Tetherin, HM1.24 antigen, Bone marrow stromal antigen 2
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
IGFBP6 PrEST Antigen
IGFBP6 PrEST Antigen

Item number: ATA-APrEST95724.100

Atlas Antibodies
PrEST Antigen IGFBP6, Gene description: insulin like growth factor binding protein 6, Antigen sequence: CPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: IGF-binding proteins prolong the half-life of the IGFs and have...
Keywords: IBP6, IBP-6, IGFBP-6, IGF-binding protein 6, Insulin-like growth factor-binding protein 6
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
UBASH3B PrEST Antigen
UBASH3B PrEST Antigen

Item number: ATA-APrEST95725.100

Atlas Antibodies
PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B, Alternative Gene Names: KIAA1959, STS-1, TULA-2, TULA2, Antigen sequence: YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: STS-1, TULA-2, UBASH3B, KIAA1959, EC=3.1.3.48, T-cell ubiquitin ligand 2, Cbl-interacting protein p70, Tyrosine-protein...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TNFRSF11B PrEST Antigen
TNFRSF11B PrEST Antigen

Item number: ATA-APrEST95729.100

Atlas Antibodies
PrEST Antigen TNFRSF11B, Gene description: TNF receptor superfamily member 11b, Alternative Gene Names: OCIF, OPG, TR1, Antigen sequence: SSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as decoy...
Keywords: OCIF, TNFRSF11B, Osteoprotegerin, Osteoclastogenesis inhibitory factor, Tumor necrosis factor receptor superfamily member 11B
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
13033 from 13202 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure