PPP3CC PrEST Antigen

PPP3CC PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95711.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma,... more
Product information "PPP3CC PrEST Antigen"
PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32. [The UniProt Consortium] Mouse gene identity: 97% Rat gene identity: 97%
Keywords: PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95711

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PPP3CC PrEST Antigen"
Write a review
or to review a product.
Viewed