UBASH3B PrEST Antigen

UBASH3B PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95725.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B,... more
Product information "UBASH3B PrEST Antigen"
PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B, Alternative Gene Names: KIAA1959, STS-1, TULA-2, TULA2, Antigen sequence: YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Exhibits tyrosine phosphatase activity toward several substrates including EGFR, FAK, SYK, and ZAP70. Down-regulates proteins that are dually modified by both protein tyrosine phosphorylation and ubiquitination. [The UniProt Consortium] Mouse gene identity: 93% Rat gene identity: 93%
Keywords: STS-1, TULA-2, UBASH3B, KIAA1959, EC=3.1.3.48, T-cell ubiquitin ligand 2, Cbl-interacting protein p70, Tyrosine-protein phosphatase STS1/TULA2, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95725

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "UBASH3B PrEST Antigen"
Write a review
or to review a product.
Viewed