Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against... read more »
Close window
Proteins and Peptides

Proteins are essential components of all living cells, as they fulfill countless biological functions within organisms. These functions comprise, for example, enzyme catalysis, defense against pathogens, transport of molecules, structural maintenance of the cell and regulatory functions. Major protein goups are antibodies, enzymes, cytokines, hormones, signalling peptides, structural components and transport proteins. We offer a broad portfolio of protein products, including recombinant proteins, enzymes, cytokines and peptides, for researchers in molecular biology, cell biology, biochemistry and many other scientific fields. The products can be used for a large variety of investigations and applications, such as protein-protein interaction and protein localisation studies, enzymatic assays, Western blots (e.g. as control) and immunohistochemistry. 

Filter
12867 from 13031 pages
No results were found for the filter!
DSG4 PrEST Antigen
DSG4 PrEST Antigen

Item number: ATA-APrEST95823.100

Atlas Antibodies
PrEST Antigen DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Antigen sequence: PAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of intercellular...
Keywords: DSG4, CDHF13, Desmoglein-4, Cadherin family member 13
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
AXIN1 PrEST Antigen
AXIN1 PrEST Antigen

Item number: ATA-APrEST95824.100

Atlas Antibodies
PrEST Antigen AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Antigen sequence: AWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the beta-catenin destruction...
Keywords: AXIN, hAxin, AXIN1, Axin-1, Axis inhibition protein 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZNF728 PrEST Antigen
ZNF728 PrEST Antigen

Item number: ATA-APrEST95826.100

Atlas Antibodies
PrEST Antigen ZNF728, Gene description: zinc finger protein 728, Antigen sequence: HELVKEPPGRTGHELWLRKLELSLGTAIGTKVCRPASIALNGYHSPGLWKTQDLSQTVAGRSLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 31% Rat gene identity: 31%
Keywords: ZNF728, Zinc finger protein 728
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZNF333 PrEST Antigen
ZNF333 PrEST Antigen

Item number: ATA-APrEST95831.100

Atlas Antibodies
PrEST Antigen ZNF333, Gene description: zinc finger protein 333, Alternative Gene Names: KIAA1806, Antigen sequence: QCQPQEAIPSQDTFTEILSIDVKGEQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASCECQEIRNSFFQSAHLIVPEKIRSGDKSYACNKCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
Keywords: ZNF333, KIAA1806, Zinc finger protein 333
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
LYL1 PrEST Antigen
LYL1 PrEST Antigen

Item number: ATA-APrEST95852.100

Atlas Antibodies
PrEST Antigen LYL1, Gene description: LYL1 basic helix-loop-helix family member, Alternative Gene Names: bHLHa18, Antigen sequence: TAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 91% Rat gene identity: 91%
Keywords: LYL1, bHLHa18, BHLHA18, Protein lyl-1, Class A basic helix-loop-helix protein 18, Lymphoblastic leukemia-derived sequence 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
FADS2 PrEST Antigen
FADS2 PrEST Antigen

Item number: ATA-APrEST95855.100

Atlas Antibodies
PrEST Antigen FADS2, Gene description: fatty acid desaturase 2, Alternative Gene Names: D6D, DES6, FADSD6, LLCDL2, SLL0262, TU13, Antigen sequence: PDVNMLHVFVLGEWQPIEYGKKKLK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in the biosynthesis of highly unsaturated...
Keywords: D6D, Delta-6 desaturase, Delta(6) desaturase, Acyl-CoA 6-desaturase, Fatty acid desaturase 2, Delta(6) fatty acid desaturase
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
BORCS7 PrEST Antigen
BORCS7 PrEST Antigen

Item number: ATA-APrEST95857.100

Atlas Antibodies
PrEST Antigen BORCS7, Gene description: BLOC-1 related complex subunit 7, Alternative Gene Names: C10orf32, FLJ40752, Antigen sequence: ARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: As part of the BORC complex may...
Keywords: Diaskedin, BLOC-1-related complex subunit 7
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
BPIFB4 PrEST Antigen
BPIFB4 PrEST Antigen

Item number: ATA-APrEST95860.100

Atlas Antibodies
PrEST Antigen BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Antigen sequence: PKDLETTICLIDVDTELLASFSIEGDKLMIDAKLEKTSLNLRTSNVGNFDIGLMEVLVEKIFDLAFMPAMNAVLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: BPIFB4, C20orf186, Ligand-binding protein RY2G5, BPI fold-containing family B member 4, Long palate, lung and nasal...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
LRCH2 PrEST Antigen
LRCH2 PrEST Antigen

Item number: ATA-APrEST95861.100

Atlas Antibodies
PrEST Antigen LRCH2, Gene description: leucine rich repeats and calponin homology domain containing 2, Alternative Gene Names: KIAA1495, Antigen sequence: RNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVS, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: LRCH2, KIAA1495, Leucine-rich repeat and calponin homology domain-containing protein 2
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
PPARGC1A PrEST Antigen
PPARGC1A PrEST Antigen

Item number: ATA-APrEST95869.100

Atlas Antibodies
PrEST Antigen PPARGC1A, Gene description: PPARG coactivator 1 alpha, Alternative Gene Names: PGC-1alpha, PGC1, PGC1A, PPARAGCIalpha, PPARGC1, Antigen sequence: PPHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSKSSVLTGGHEERKTKRPSLRLF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: LEM6, PPARGC1A, PGC-1-alpha, PPARGC-1-alpha, Ligand effect modulator 6, PPAR-gamma coactivator 1-alpha, Peroxisome...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TPT1 PrEST Antigen
TPT1 PrEST Antigen

Item number: ATA-APrEST95870.100

Atlas Antibodies
PrEST Antigen TPT1, Gene description: tumor protein, translationally-controlled 1, Alternative Gene Names: fortilin, TCTP, Antigen sequence: AAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKCVSTRKWV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in calcium...
Keywords: HRF, p23, TPT1, TCTP, Fortilin, Histamine-releasing factor, Translationally-controlled tumor protein
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CBX6 PrEST Antigen
CBX6 PrEST Antigen

Item number: ATA-APrEST95872.100

Atlas Antibodies
PrEST Antigen CBX6, Gene description: chromobox 6, Antigen sequence: RSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class...
Keywords: CBX6, Chromobox protein homolog 6
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
12867 from 13031 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure