CBX6 PrEST Antigen

CBX6 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95872.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen CBX6, Gene description: chromobox 6, Antigen sequence:... more
Product information "CBX6 PrEST Antigen"
PrEST Antigen CBX6, Gene description: chromobox 6, Antigen sequence: RSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed:21282530). PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Possibly contributes to the target selectivity of the PRC1 complex by binding specific regions of chromatin (PubMed:18927235). Recruitment to chromatin might occur in an H3K27me3- independent fashion. May have a PRC1-independent function in embryonic stem cells. [The UniProt Consortium] Mouse gene identity: 75% Rat gene identity: 75%
Keywords: CBX6, Chromobox protein homolog 6
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95872

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CBX6 PrEST Antigen"
Write a review
or to review a product.
Viewed