BPIFB4 PrEST Antigen

PrEST Antigen BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Antigen sequence: PKDLETTICLIDVDTELLASFSIEGDKLMIDAKLEKTSLNLRTSNVGNFDIGLMEVLVEKIFDLAFMPAMNAVLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May have the capacity to recognize and bind specific classes of odorants. May act as a carrier molecule, transporting odorants across the mucus layer to access receptor sites. May serve as a primary defense mechanism by recognizing and removing potentially harmful odorants or pathogenic microorganisms from the mucosa or clearing excess odorant from mucus to enable new odorant stimuli to be received. [The UniProt Consortium] Mouse gene identity: 85% Rat gene identity: 85%