Anti-Osteopontin / OPN / SPP1

Anti-Osteopontin / OPN / SPP1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31935 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteopontin (OPN), also known as secreted... mehr
Produktinformationen "Anti-Osteopontin / OPN / SPP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. Protein function: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. [The UniProt Consortium]
Schlagworte: Anti-BNSP, Anti-SPP1, Anti-SPP-1, Anti-PSEC0156, Anti-Uropontin, Anti-Osteopontin, Anti-Nephropontin, Anti-Bone sialoprotein 1, Anti-Urinary stone protein, Anti-Secreted phosphoprotein 1, Osteopontin Antibody / OPN / SPP1
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31935

Eigenschaften

Anwendung: WB, ELISA
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN of human Osteopontin/SPP1 were used as the immunogen for the SPP1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Osteopontin / OPN / SPP1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen