Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
HDAC5 PrEST Antigen
Item number: ATA-APrEST95948.100
PrEST Antigen HDAC5, Gene description: histone deacetylase 5, Alternative Gene Names: FLJ90614, KIAA0600, NY-CO-9, Antigen sequence: VTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | HD5, HDAC5, KIAA0600, EC=3.5.1.98, Antigen NY-CO-9, Histone deacetylase 5 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RASGRP3 PrEST Antigen
Item number: ATA-APrEST95949.100
PrEST Antigen RASGRP3, Gene description: RAS guanyl releasing protein 3, Alternative Gene Names: CalDAG-GEFIII, GRP3, KIAA0846, Antigen sequence: AITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | GRP3, RASGRP3, Ras guanyl-releasing protein 3, Guanine nucleotide exchange factor for Rap1, Calcium and DAG-regulated... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
BAZ1B PrEST Antigen
Item number: ATA-APrEST95952.100
PrEST Antigen BAZ1B, Gene description: bromodomain adjacent to zinc finger domain 1B, Alternative Gene Names: WBSCR10, WBSCR9, WSTF, Antigen sequence: LVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Keywords: | BAZ1B, hWALp2, WBSC10, EC=2.7.10.2, Tyrosine-protein kinase BAZ1B, Williams syndrome transcription factor, Bromodomain... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
TMEM54 PrEST Antigen
Item number: ATA-APrEST95956.100
PrEST Antigen TMEM54, Gene description: transmembrane protein 54, Alternative Gene Names: BCLP, CAC-1, Antigen sequence: HGTVLRYVGTPQDAVALQYCVVNI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 67% Rat gene identity: 67%
| Keywords: | BCLP, TMEM54, Protein CAC-1, Beta-casein-like protein, Transmembrane protein 54 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
TENM1 PrEST Antigen
Item number: ATA-APrEST95960.100
PrEST Antigen TENM1, Gene description: teneurin transmembrane protein 1, Alternative Gene Names: ODZ1, ODZ3, TEN-M1, TEN1, TNM, Antigen sequence: DGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | ODZ1, TENM1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
MLLT10 PrEST Antigen
Item number: ATA-APrEST95961.100
PrEST Antigen MLLT10, Gene description: MLLT10 histone lysine methyltransferase DOT1L cofactor, Alternative Gene Names: AF10, Antigen sequence: IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | Protein AF-10, ALL1-fused gene from chromosome 10 protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CCDC110 PrEST Antigen
Item number: ATA-APrEST95963.100
PrEST Antigen CCDC110, Gene description: coiled-coil domain containing 110, Alternative Gene Names: CT52, KM-HN-1, MGC33607, Antigen sequence: KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQREYLSLSDKICNQHNDPSKTTYISRREKFHFDNYTHEDT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse...
| Keywords: | CT52, KMHN1, CCDC110, Cancer/testis antigen 52, Cancer/testis antigen KM-HN-1, Coiled-coil domain-containing protein 110 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
SLC38A7 PrEST Antigen
Item number: ATA-APrEST95964.100
PrEST Antigen SLC38A7, Gene description: solute carrier family 38 member 7, Alternative Gene Names: FLJ10815, Antigen sequence: QQDKIIAVMAKEPEGASGPWYTDRK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Mediates sodium-dependent transport of amino acids, preferentially...
| Keywords: | SNAT7, SLC38A7, Solute carrier family 38 member 7, Putative sodium-coupled neutral amino acid transporter 7 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
MAF1 PrEST Antigen
Item number: ATA-APrEST95968.100
PrEST Antigen MAF1, Gene description: MAF1 homolog, negative regulator of RNA polymerase III, Alternative Gene Names: DKFZp586G1123, Antigen sequence: FSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | MAF1, Repressor of RNA polymerase III transcription MAF1 homolog |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PBXIP1 PrEST Antigen
Item number: ATA-APrEST95969.100
PrEST Antigen PBXIP1, Gene description: PBX homeobox interacting protein 1, Alternative Gene Names: HPIP, Antigen sequence: PGVSANASKAWHQKSHFQNSREWSGKEKWWDGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Regulator of...
| Keywords: | HPIP, PBXIP1, Hematopoietic PBX-interacting protein, Pre-B-cell leukemia transcription factor-interacting protein 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
KHDC1L PrEST Antigen
Item number: ATA-APrEST95970.100
PrEST Antigen KHDC1L, Gene description: KH domain containing 1 like, Alternative Gene Names: RP11-257K9.7, Antigen sequence: PMVFHMEEDQEELIFGLDDTYLRCIE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 65% Rat gene identity: 65%
| Keywords: | KHDC1L, Putative KHDC1-like protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CTSW PrEST Antigen
Item number: ATA-APrEST95971.100
PrEST Antigen CTSW, Gene description: cathepsin W, Antigen sequence: EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May have a specific function in the mechanism or regulation of T-cell...
| Keywords: | CTSW, Lymphopain, Cathepsin W, EC=3.4.22.- |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*