MLLT10 PrEST Antigen

MLLT10 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95961.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen MLLT10, Gene description: MLLT10 histone lysine methyltransferase DOT1L cofactor,... more
Product information "MLLT10 PrEST Antigen"
PrEST Antigen MLLT10, Gene description: MLLT10 histone lysine methyltransferase DOT1L cofactor, Alternative Gene Names: AF10, Antigen sequence: IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Probably involved in transcriptional regulation. In vitro or as fusion protein with KMT2A/MLL1 has transactivation activity. Binds to cruciform DNA. In cells, binding to unmodified histone H3 regulates DOT1L functions including histone H3 'Lys-79' dimethylation (H3K79me2) and gene activation (PubMed:26439302). [The UniProt Consortium] Mouse gene identity: 72% Rat gene identity: 72%
Keywords: Protein AF-10, ALL1-fused gene from chromosome 10 protein
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95961

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "MLLT10 PrEST Antigen"
Write a review
or to review a product.
Viewed