TENM1 PrEST Antigen

TENM1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95960.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen TENM1, Gene description: teneurin transmembrane protein 1, Alternative Gene Names:... more
Product information "TENM1 PrEST Antigen"
PrEST Antigen TENM1, Gene description: teneurin transmembrane protein 1, Alternative Gene Names: ODZ1, ODZ3, TEN-M1, TEN1, TNM, Antigen sequence: DGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in neural development, regulating the establishment of proper connectivity within the nervous system. May function as a cellular signal transducer. [The UniProt Consortium] Mouse gene identity: 91% Rat gene identity: 91%
Keywords: ODZ1, TENM1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95960

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "TENM1 PrEST Antigen"
Write a review
or to review a product.
Viewed