- Search results for Q9HC21
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "Q9HC21"!
Close filters
Filter by:
No results were found for the filter!
Item number: TGM-TMPH-02333-10ug
Description: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. SLC25A19 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 37.0 kDa and the accession number is Q9HC21.
| Keywords: | Mitochondrial thiamine pyrophosphate transporter (MTPPT) , Mitochondrial thiamine pyrophosphate carrier , SLC25A19 , DNC ,... |
| MW: | 37 kD |
From 510.00€
*
Item number: CSB-CF864025HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-320aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MVGYDPKPDG RNNTKFQVAV AGSVSGLVTR ALISPFDVIK IRFQLQHERL SRSDPSAKYH GILQASRQIL QEEGPTAFWK GHVPAQILSI GYGAVQFLSF EMLTELVHRG...
| Keywords: | DNC, SLC25A19, Mitochondrial uncoupling protein 1, Solute carrier family 25 member 19, Mitochondrial thiamine... |
| Application: | Activity not tested |
| Expressed in: | E.coli in vitro |
| Origin: | human |
| MW: | 37.0 kD |
From 1,458.00€
*
Item number: TGM-TMPH-02333-100ug
Description: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. SLC25A19 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 37.0 kDa and the accession number is Q9HC21.
| Keywords: | SLC25A19, Solute carrier family 25 member 19, Mitochondrial thiamine pyrophosphate transporter, Mitochondrial uncoupling... |
| MW: | 37.0 kD |
From 1,450.00€
*
Item number: ATA-HPA021936.100
Polyclonal Antibody against Human SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Validated applications: ICC, Uniprot ID: Q9HC21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Mitochondrial...
| Keywords: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: E-AB-65956.120
This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein...
| Keywords: | Anti-DNC, Anti-SLC25A19, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial uncoupling protein 1,... |
| Application: | IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 243.00€
*
Item number: ATA-HPA021936.25
Polyclonal Antibody against Human SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Validated applications: ICC, Uniprot ID: Q9HC21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Mitochondrial...
| Keywords: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: VHPS-8494
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | DNC, SLC25A19, Solute carrier family 25 member 19, Mitochondrial uncoupling protein 1, Mitochondrial thiamine... |
| Application: | RNA quantification |
45.00€
*
Item number: 041852.200
SLC25A19 encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein...
| Keywords: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
865.00€
*
Item number: NSJ-RQ6117
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mitochondrial thiamine pyrophosphate carrier is a protein that in humans is encoded by the SLC25A19 gene. This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial...
| Keywords: | Anti-DNC, Anti-SLC25A19, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial uncoupling protein 1,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
790.00€
*
Item number: G-CAB12373.100
WB 1:500 - 1:2000, IF 1:50 - 1:200. Protein function: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. [The UniProt Consortium]
| Keywords: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Application: | WB, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 103.00€
*
Item number: ELK-ES18865.100
Protein function: Mitochondrial transporter mediating uptake of thiamine diphosphate into mitochondria. It is not clear if the antiporter activity is affected by the membrane potential or by the proton electrochemical gradient. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization:...
| Keywords: | Anti-MTPPT, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial thiamine... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: ATA-APrEST96009.100
PrEST Antigen SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Antigen sequence: PKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | DNC, SLC25A19, Mitochondrial uncoupling protein 1, Solute carrier family 25 member 19, Mitochondrial thiamine... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*