SLC25A19 PrEST Antigen

SLC25A19 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96009.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene... more
Product information "SLC25A19 PrEST Antigen"
PrEST Antigen SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Antigen sequence: PKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. [The UniProt Consortium] Mouse gene identity: 81% Rat gene identity: 81%
Keywords: DNC, SLC25A19, Mitochondrial uncoupling protein 1, Solute carrier family 25 member 19, Mitochondrial thiamine pyrophosphate carrier
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96009

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "SLC25A19 PrEST Antigen"
Write a review
or to review a product.
Viewed