2 products were found matching "Q9GLP1"!

No results were found for the filter!

Coagulation factor V (F5), partial, swine, recombinant

Item number: CSB-EP872389PI.1

Organism: Sus scrofa (Pig). Source: E.coli. Expression Region: 1616-1785aa. Protein Length: Partial. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: NRRNYYIAAE ELSWDYSKFT QREDIDDVPE HTIYKKVVFR KYLDSTFTKL DPRGEYEEHL GILGPIIRAE VDDVIQVRFK NLASRPYSLH AHGLSYEKSS EGKTYEDDSP EWFKEDNAVQ PNSSYTYVWH ATERSGPESP...

Keywords:	F5, Recombinant Pig Coagulation factor V (F5), partial
Application:	Activity not tested
Expressed in:	E.coli
Origin:	swine
MW:	26.6 kD

From 247.00€ *

Show details

Review

Coagulation Factor V (F5) Recombinant, Porcine

Item number: 154065.10

Source:, Recombinant Porcine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9GLP1, Fragment: Cys1941~Cys2095 (Accession No: Q9GLP1), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-CKMPMGLSTG LIADSQIKAS EFWGHWQPKL ARLNNGGSYN AWITDKFSGE SNSKPWIQVD...

From 437.00€ *

Show details

Review

Didn't find the right Product? Here are some useful Search Tips!

Checklist-Thumbnail

All our products have English titles and descriptions. Therefore, use English search terms.
Write out Greek letters - i.e. "alpha" instead of α or "beta" instead of β.
Do not add "and" when entering multiple search terms.
Use the singular (e.g. "antibody" instead of "antibodies").
If available, try synonyms (e.g. for a specific protein).
You can search for chemical substances using the unique CAS number (Chemical Abstracts Service).
In addition, you can also use the UniProt or KEGG accession number for the product search.
Use our filter function to narrow down your search results. If you want to remove a selected filter again, click on the small "x" next to the filter.
Are you looking for products from a specific supplier? Then enter the corresponding supplier name and select it in the appearing suggestion field. Alternatively, you can also use our supplier overview.
Use - if known - the specific product number. Especially for short numbers, note the supplier code in front of each number for most of our partners (e.g. for AAT Bioquest "ABD-121" instead of just "121"). Click on the button below to find all supplier codes and additional information.

All Supplier Codes

We would be very happy to support you in your product search! Contact us at info@biomol.com.