- Search results for Q9GLP1
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
2 products were found matching "Q9GLP1"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-EP872389PI.1
Organism: Sus scrofa (Pig). Source: E.coli. Expression Region: 1616-1785aa. Protein Length: Partial. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: NRRNYYIAAE ELSWDYSKFT QREDIDDVPE HTIYKKVVFR KYLDSTFTKL DPRGEYEEHL GILGPIIRAE VDDVIQVRFK NLASRPYSLH AHGLSYEKSS EGKTYEDDSP EWFKEDNAVQ PNSSYTYVWH ATERSGPESP...
| Keywords: | F5, Recombinant Pig Coagulation factor V (F5), partial |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 26.6 kD |
From 247.00€
*
Item number: 154065.10
Source:, Recombinant Porcine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9GLP1, Fragment: Cys1941~Cys2095 (Accession No: Q9GLP1), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-CKMPMGLSTG LIADSQIKAS EFWGHWQPKL ARLNNGGSYN AWITDKFSGE SNSKPWIQVD...
From 437.00€
*
