This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Product information "Coagulation Factor V (F5) Recombinant, Porcine"
Source:, Recombinant Porcine from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9GLP1, Fragment: Cys1941~Cys2095 (Accession No: Q9GLP1), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-CKMPMGLSTG LIADSQIKAS EFWGHWQPKL ARLNNGGSYN AWITDKFSGE SNSKPWIQVD MQREVVFTGI QTQGAKYYLK SYYTTEFNVA YSSDQRNWRI FKGNSTKNVM YFNGNSDAST ITENQFDPPV VARYIRISPT ESYNKPALRL ELQGC, Epitope Tag: N-terminal Tags: His-tag and S-tag, Molecular Weight: 23.3kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent.
More information