8 products were found matching "Q96PM9"!

Polyclonal Antibody against Human ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Validated applications: ICC, WB, Uniprot ID: Q96PM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...

Polyclonal Antibody against Human ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Validated applications: ICC, WB, Uniprot ID: Q96PM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- or double-stranded RNA, or interact with other proteins (Sharma et al., 2004 [PubMed 15527981]). Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot:...

Length: 1101 Sequence: atgcagcccc cactggacct caagcagatc ctgcccttcc cactcgagcc agcccctacc cttggcctct tcagcaacta cagcaccatg gaccctgtgc agaaggctgt gctctcccac acttttgggg gacccttgct caagaccaag cggcccgtca tttcctgtaa tatctgtcaa atccgcttca attctcagag ccaggctgag gcgcactaca aaggtaatcg ccacgcccga cgagtcaaag gcattgaggc...

Protein function: RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje cells, and may regulate its activity-dependent...

PrEST Antigen ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Antigen sequence: PVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein...

Protein function: RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje cells, and may regulate its activity-dependent...