16 products were found matching "P43027"!

1 from 2 pages
No results were found for the filter!
-10 %
Discount Promotion
Mouse GDF5 (Growth Differentiation Factor 5) ELISA Kit
Mouse GDF5 (Growth Differentiation Factor 5) ELISA Kit

Item number: ELK-ELK6710.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse GDF5. Next,...
Keywords: Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5
Application: ELISA
Species reactivity: mouse
365.00€ * From 328.50€ *
Review
Mouse GDF-5 / BMP14 ELISA Kit
Mouse GDF-5 / BMP14 ELISA Kit

Item number: G-MOFI00249.96

Application: ELISA
Species reactivity: mouse
694.00€ *
Review
Mouse GDF5 (Growth Differentiation Factor 5) CLIA Kit
Mouse GDF5 (Growth Differentiation Factor 5) CLIA Kit

Item number: G-MOES00317.96

ELISA Type: CLIA. Sensitivity: 18.75 ng/mL. Range: 31.25--2000 ng/mL. Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue...
Keywords: Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5
Application: CLIA
Species reactivity: mouse
694.00€ *
Review
-20 %
Discount Promotion
Human GDF5 recombinant protein (Active)
Human GDF5 recombinant protein (Active)

Item number: ARG70100.100

Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with...
Keywords: Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5
Application: SDS-PAGE, Cell culture
Origin: human
336.00€ * From 268.80€ *
Review
Mouse GDF5 ELISA Kit
Mouse GDF5 ELISA Kit

Item number: ARG82352.96

Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with...
Keywords: Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5
Application: ELISA
Species reactivity: mouse
1,416.00€ *
Review
Anti-Gdf5
Anti-Gdf5

Item number: G-PACO26937.50

Gdf5 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA, IHC applications. Gdf5 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Growth factor involved in bone and cartilage formation. During cartilage development...
Keywords: Anti-Gdf5, Anti-Bmp14, Anti-GDF-5, Anti-BMP-14, Anti-Bone morphogenetic protein 14, Anti-Growth/differentiation factor 5
Application: ELISA, IHC
Host: Rabbit
Species reactivity: mouse
363.00€ *
Review
Mouse GDF5 (Growth Differentiation Factor 5) CLIA Kit
Mouse GDF5 (Growth Differentiation Factor 5) CLIA Kit

Item number: E-CL-M0364.24

Type: Sandwich. Detection Range: 31.25~2000ng/mL. Sensitivity: 18.75ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5 . Standards or...
Keywords: Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5
Application: CLIA
Species reactivity: mouse
From 142.00€ *
Review
Gdf5, Mouse growth differentiation factor 5, Real Time PCR Primer Set
Gdf5, Mouse growth differentiation factor 5, Real Time...

Item number: VMPS-2408

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Gdf5, Growth differentiation factor 5
Application: RNA quantification
43.00€ *
Review
Anti-Growth and Differentiation Factor 5 (GDF5)
Anti-Growth and Differentiation Factor 5 (GDF5)

Item number: G8989-45A.500

Growth Differentiation Factor 5 (GDF5) is a member of the bone morphogenetic protein (BMP) subfamily of the TGF-beta superfamily. It is synthesized as a large precursor protein that consists of an N-terminal 19aa signal sequence, a 362aa pro region and a 130aa C-terminal mature peptide (aa376-495). Homodimeric GDF5...
Keywords: Anti-Gdf5, Anti-GDF-5, Anti-Bmp14, Anti-BMP-14, Anti-Bone morphogenetic protein 14, Anti-Growth/differentiation factor 5
Application: ELISA, Neutr.
Host: Rat
Species reactivity: mouse
1,189.00€ *
Review
Growth Differentiation Factor 5 (GDF5) BioAssay(TM) ELISA Kit (Mouse)
Growth Differentiation Factor 5 (GDF5) BioAssay(TM) ELISA...

Item number: 025491.96

Growth Differentiation Factor 5 (GDF5) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of GDF5 in mouse serum, plasma, tissue homogenates and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.065ng/m, Storage and Stability: Desiccation...
Keywords: Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5
Application: ELISA
Species reactivity: mouse
1,016.00€ *
Review
Growth Differentiation Factor 5 (GDF5) Recombinant, Mouse
Growth Differentiation Factor 5 (GDF5) Recombinant, Mouse

Item number: 154921.10

Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P43027, Fragment: Gln358~Arg495 (Accession No: P43027), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-QDD KTVYEYLFSQ RRKRRAPLAN RQGKRPSKNL KARCSRKALH VNFKDMGWDD WIIAPLEYEA...
From 387.00€ *
Review
Mouse GDF5 (Growth Differentiation Factor 5) CLIA Kit
Mouse GDF5 (Growth Differentiation Factor 5) CLIA Kit

Item number: E-CL-M0364.96

Type: Sandwich. Detection Range: 31.25~2000ng/mL. Sensitivity: 18.75ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5 . Standards or...
Keywords: Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5
Application: CLIA
Species reactivity: mouse
541.00€ *
Review
1 from 2 pages