- Search results for P43027
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
16 products were found matching "P43027"!
Close filters
Filter by:
No results were found for the filter!
-10 %
Discount Promotion
Item number: ELK-ELK6710.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse GDF5. Next,...
Keywords: | Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Application: | ELISA |
Species reactivity: | mouse |
365.00€
*
From 328.50€
*
Item number: G-MOFI00249.96
Application: | ELISA |
Species reactivity: | mouse |
694.00€
*
Item number: G-MOES00317.96
ELISA Type: CLIA. Sensitivity: 18.75 ng/mL. Range: 31.25--2000 ng/mL. Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue...
Keywords: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Application: | CLIA |
Species reactivity: | mouse |
694.00€
*
-20 %
Discount Promotion
Item number: ARG70100.100
Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with...
Keywords: | Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Application: | SDS-PAGE, Cell culture |
Origin: | human |
336.00€
*
From 268.80€
*
Item number: ARG82352.96
Protein function: Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with...
Keywords: | Gdf5, GDF-5, Bmp14, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Application: | ELISA |
Species reactivity: | mouse |
1,416.00€
*
Item number: G-PACO26937.50
Gdf5 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA, IHC applications. Gdf5 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Growth factor involved in bone and cartilage formation. During cartilage development...
Keywords: | Anti-Gdf5, Anti-Bmp14, Anti-GDF-5, Anti-BMP-14, Anti-Bone morphogenetic protein 14, Anti-Growth/differentiation factor 5 |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | mouse |
363.00€
*
Item number: E-CL-M0364.24
Type: Sandwich. Detection Range: 31.25~2000ng/mL. Sensitivity: 18.75ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5 . Standards or...
Keywords: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Application: | CLIA |
Species reactivity: | mouse |
From 142.00€
*
Item number: VMPS-2408
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | Gdf5, Growth differentiation factor 5 |
Application: | RNA quantification |
43.00€
*
Item number: G8989-45A.500
Growth Differentiation Factor 5 (GDF5) is a member of the bone morphogenetic protein (BMP) subfamily of the TGF-beta superfamily. It is synthesized as a large precursor protein that consists of an N-terminal 19aa signal sequence, a 362aa pro region and a 130aa C-terminal mature peptide (aa376-495). Homodimeric GDF5...
Keywords: | Anti-Gdf5, Anti-GDF-5, Anti-Bmp14, Anti-BMP-14, Anti-Bone morphogenetic protein 14, Anti-Growth/differentiation factor 5 |
Application: | ELISA, Neutr. |
Host: | Rat |
Species reactivity: | mouse |
1,189.00€
*
Item number: 025491.96
Growth Differentiation Factor 5 (GDF5) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of GDF5 in mouse serum, plasma, tissue homogenates and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.065ng/m, Storage and Stability: Desiccation...
Keywords: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Application: | ELISA |
Species reactivity: | mouse |
1,016.00€
*
Item number: 154921.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P43027, Fragment: Gln358~Arg495 (Accession No: P43027), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-QDD KTVYEYLFSQ RRKRRAPLAN RQGKRPSKNL KARCSRKALH VNFKDMGWDD WIIAPLEYEA...
From 387.00€
*
Item number: E-CL-M0364.96
Type: Sandwich. Detection Range: 31.25~2000ng/mL. Sensitivity: 18.75ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse GDF5 . Standards or...
Keywords: | Gdf5, Bmp14, GDF-5, BMP-14, Bone morphogenetic protein 14, Growth/differentiation factor 5 |
Application: | CLIA |
Species reactivity: | mouse |
541.00€
*