- Search results for P06340
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "P06340"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA045038.100
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest...
| Keywords: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-PA002934.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 126.00€
*
Item number: CSB-PA113671.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
Item number: ATA-HPA076922.100
Polyclonal Antibody against Human HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Validated applications: IHC, Uniprot ID: P06340, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Keywords: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: VHPS-4155
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | MHC DZ alpha, MHC DN-alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha chain |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST83887.100
Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | HLA-DOA, HLA-DNA, MHC DZ alpha, MHC DN-alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABD-8C16218.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-HLA-DOA with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Keywords: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DZ alpha, Anti-MHC DN-alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
628.00€
*
Item number: ELK-ES2536.100
HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little...
| Keywords: | Anti-HLA-DOA, Anti-HLA-DNA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Application: | WB, IHC, IF, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 173.00€
*
Item number: CSB-CL356784HU.10
Length: 753 Sequence: atggccctca gagcagggct ggtcctgggg ttccacaccc tgatgaccct cctgagcccg caggaggcag gggccaccaa ggctgaccac atgggctcct acggacccgc cttctaccag tcttacggcg cctcgggcca gttcacccat gaatttgatg aggaacagct gttctctgtg gacctgaaga aaagcgaggc cgtgtggcgt ctgcctgagt ttggcgactt tgcccgcttt gacccgcagg gcgggctggc...
| Keywords: | HLA-DNA, HLA-DOA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA356784ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: HLA-DOA. Antigen Species: Human
| Keywords: | Anti-HLA-DNA, Anti-HLA-DOA, Anti-MHC DN-alpha, Anti-MHC DZ alpha, Anti-MHC class II antigen DOA, Anti-HLA class II... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ATA-APrEST95717.100
PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | HLA-DOA, HLA-DNA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*