20 products were found matching "K10097"!

1 from 2 pages
No results were found for the filter!
Anti-LGALS14
Anti-LGALS14

Item number: G-PACO39478.50

LGALS14 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. LGALS14 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt...
Keywords: Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
313.00€ *
Review
Human Galectin 14 recombinant protein (His-tagged)
Human Galectin 14 recombinant protein (His-tagged)

Item number: ARG70467.100

Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
Keywords: CLC2, CLC2, PPL13, Gal-14, Gal-14, LGALS14, Galectin-14, Galectin-14, Placental protein 13-like, Placental protein...
Application: SDS-PAGE
Origin: human
From 370.00€ *
Review
PPL13, Human, Real Time PCR Primer Set
PPL13, Human, Real Time PCR Primer Set

Item number: VHPS-7141

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2
Application: RNA quantification
45.00€ *
Review
Anti-Galectin-14 (LGALS14 lectin, galactoside-binding, soluble, Charcot-Leyden crystal protein 2, CL
Anti-Galectin-14 (LGALS14 lectin, galactoside-binding,...

Item number: G1044-71.100

Galectin-14, also known as placental protein 13-like (PPL13), belongs the galectin family of carbohydrate binding proteins. It is expressed intracellularly in placenta and eosinophils and is released by eosinophils following allergen stimulation. Galectin-14 may be involved in the development of allergic...
Keywords: Anti-Gal-14
Application: WB
Host: Mouse
Species reactivity: human, mouse
969.00€ *
Review
Galectin-14, His Tag, human recombinant (rHuLGALS14-His)
Galectin-14, His Tag, human recombinant (rHuLGALS14-His)

Item number: 97458.1

Human recombinant LGALS14 fused with a 23 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 162 amino acids (1-139) and having a molecular mass of 18.5kDa. Galectin14, aka LGALS14, is a member of the galectin family of carbohydrate binding proteins....
Keywords: Placental protein 13-like, Charcot-Leyden crystal protein 2, CLC2, Galectin-14, Gal-14, LGALS14, PPL13, MGC22235.
Application: Bioassay
Expressed in: E.coli
Origin: human
MW: 18500 D
From 105.00€ *
Review
LGALS14 PrEST Antigen
LGALS14 PrEST Antigen

Item number: ATA-APrEST94908.100

Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-LGALS14
Anti-LGALS14

Item number: ATA-HPA065180.100

Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Keywords: Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden...
Application: ICC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Galectin-14 protein(N-His) (recombinant human)
Galectin-14 protein(N-His) (recombinant human)

Item number: E-PKSH034189.100

Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Binds beta-galactoside and lactose. Strong...
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human...
Expressed in: E.coli
Origin: human
MW: 16.92 kD
From 241.00€ *
Review
Recombinant Human Galectin4/LGALS14 Protein (His Tag) (RPES4613)
Recombinant Human Galectin4/LGALS14 Protein (His Tag)...

Item number: G-RPES4613.10

Human Galectin4/LGALS14 Recombinant Protein (RPES4613) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2
Expressed in: Human cells
Origin: human
248.00€ *
Review
Galectin-14/LGALS14 Protein(C-6His) (recombinant human)
Galectin-14/LGALS14 Protein(C-6His) (recombinant human)

Item number: E-PKSH032472.10

Protein Construction: Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Sequence: Met 1-Asp139. Fusion tag: C-6His Endotoxin: < 1.0 EU per µg as determined by the LAL method. Apparent Molecular Mass:...
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human...
Expressed in: Human cells
Origin: human
MW: 17.1 kD
From 156.00€ *
Review
Human Galectin-14 Recombinant Protein (N-His)
Human Galectin-14 Recombinant Protein (N-His)

Item number: G-RPES6497.20

Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2
Expressed in: E.coli
Origin: human
384.00€ *
Review
LGALS14 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC
LGALS14 (Vector Vector will be determined during the...

Item number: CSB-CL848400HU.10

Length: 420 Sequence: atgtcatcac tacccgtacc atacacactg cctgtttcct tgcctgttgg ttcgtgcgtg ataatcacag ggacaccgat cctcactttt gtcaaggacc cacagctgga ggtgaatttc tacactggga tggatgagga ctcagatatt gctttccaat tccgactgca ctttggtcat cctgcaatca tgaacagtcg tgtgtttggc atatggagat atgaggagaa atgctactat ttaccctttg aagatggcaa...
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
1 from 2 pages