- Search results for K10097
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
20 products were found matching "K10097"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO39478.50
LGALS14 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. LGALS14 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt...
| Keywords: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: ARG70467.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | CLC2, CLC2, PPL13, Gal-14, Gal-14, LGALS14, Galectin-14, Galectin-14, Placental protein 13-like, Placental protein... |
| Application: | SDS-PAGE |
| Origin: | human |
From 370.00€
*
Item number: VHPS-7141
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Application: | RNA quantification |
45.00€
*
Item number: G1044-71.100
Galectin-14, also known as placental protein 13-like (PPL13), belongs the galectin family of carbohydrate binding proteins. It is expressed intracellularly in placenta and eosinophils and is released by eosinophils following allergen stimulation. Galectin-14 may be involved in the development of allergic...
| Keywords: | Anti-Gal-14 |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human, mouse |
969.00€
*
Item number: 97458.1
Human recombinant LGALS14 fused with a 23 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 162 amino acids (1-139) and having a molecular mass of 18.5kDa. Galectin14, aka LGALS14, is a member of the galectin family of carbohydrate binding proteins....
| Keywords: | Placental protein 13-like, Charcot-Leyden crystal protein 2, CLC2, Galectin-14, Gal-14, LGALS14, PPL13, MGC22235. |
| Application: | Bioassay |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18500 D |
From 105.00€
*
Item number: ATA-APrEST94908.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-HPA065180.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
| Keywords: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: E-PKSH034189.100
Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Binds beta-galactoside and lactose. Strong...
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16.92 kD |
From 241.00€
*
Item number: G-RPES4613.10
Human Galectin4/LGALS14 Recombinant Protein (RPES4613) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Expressed in: | Human cells |
| Origin: | human |
248.00€
*
Item number: E-PKSH032472.10
Protein Construction: Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Sequence: Met 1-Asp139. Fusion tag: C-6His Endotoxin: < 1.0 EU per µg as determined by the LAL method. Apparent Molecular Mass:...
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human... |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 17.1 kD |
From 156.00€
*
Item number: G-RPES6497.20
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Expressed in: | E.coli |
| Origin: | human |
384.00€
*
Item number: CSB-CL848400HU.10
Length: 420 Sequence: atgtcatcac tacccgtacc atacacactg cctgtttcct tgcctgttgg ttcgtgcgtg ataatcacag ggacaccgat cctcactttt gtcaaggacc cacagctgga ggtgaatttc tacactggga tggatgagga ctcagatatt gctttccaat tccgactgca ctttggtcat cctgcaatca tgaacagtcg tgtgtttggc atatggagat atgaggagaa atgctactat ttaccctttg aagatggcaa...
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*