21 products were found matching "K10097"!
No results were found for the filter!
Anti-LGALS14
Item number: G-PACO39478.50
LGALS14 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. LGALS14 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt...
| Keywords: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Human Galectin 14 recombinant protein (His-tagged)
Item number: ARG70467.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | CLC2, CLC2, PPL13, Gal-14, Gal-14, LGALS14, Galectin-14, Galectin-14, Placental protein 13-like, Placental protein... |
| Application: | SDS-PAGE |
| Origin: | human |
From 370.00€
*
Human LGALS14, recombinant (C-6His)
Item number: NOV-C803.10ug
Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human... |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 17.1 kD |
From 150.00€
*
LGALS14 (human), recombinant protein
Item number: ABS-PP-3239-L.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | Placental protein 13-like, Charcot-Leyden crystal protein 2, CLC2, Galectin-14, Gal-14, Recombinant Human LGALS14 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17 kD |
From 115.00€
*
Anti-LGALS14, recombinant antibody
Item number: ABS-RC-5373.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Host: | Rabbit |
| Species reactivity: | rat |
From 232.00€
*
PPL13, Human, Real Time PCR Primer Set
Item number: VHPS-7141
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Application: | RNA quantification |
45.00€
*
Anti-Galectin-14 (LGALS14 lectin, galactoside-binding,...
Item number: G1044-71.100
Galectin-14, also known as placental protein 13-like (PPL13), belongs the galectin family of carbohydrate binding proteins. It is expressed intracellularly in placenta and eosinophils and is released by eosinophils following allergen stimulation. Galectin-14 may be involved in the development of allergic...
| Keywords: | Anti-Gal-14 |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human, mouse |
969.00€
*
Galectin-14, His Tag, human recombinant (rHuLGALS14-His)
Item number: 97458.1
Human recombinant LGALS14 fused with a 23 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 162 amino acids (1-139) and having a molecular mass of 18.5kDa. Galectin14, aka LGALS14, is a member of the galectin family of carbohydrate binding proteins....
| Keywords: | Placental protein 13-like, Charcot-Leyden crystal protein 2, CLC2, Galectin-14, Gal-14, LGALS14, PPL13, MGC22235. |
| Application: | Bioassay |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18500 D |
From 105.00€
*
LGALS14 PrEST Antigen
Item number: ATA-APrEST94908.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-LGALS14
Item number: ATA-HPA065180.100
Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
| Keywords: | Anti-CLC2, Anti-PPL13, Anti-Gal-14, Anti-LGALS14, Anti-Galectin-14, Anti-Placental protein 13-like, Anti-Charcot-Leyden... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Galectin-14 protein(N-His) (recombinant human)
Item number: E-PKSH034189.100
Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Binds beta-galactoside and lactose. Strong...
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16.92 kD |
From 241.00€
*
Recombinant Human Galectin4/LGALS14 Protein (His Tag)...
Item number: G-RPES4613.10
Human Galectin4/LGALS14 Recombinant Protein (RPES4613) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
| Keywords: | CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2 |
| Expressed in: | Human cells |
| Origin: | human |
248.00€
*