Galectin-14 protein(N-His) (recombinant human)

Galectin-14 protein(N-His) (recombinant human)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSH034189.20 20 µg -

7 - 16 business days*

241.00€
E-PKSH034189.100 100 µg -

7 - 16 business days*

632.00€
 
Sequence:... more
Product information "Galectin-14 protein(N-His) (recombinant human)"
Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. [The UniProt Consortium]
Keywords: CLC2, PPL13, Gal-14, LGALS14, Galectin-14, Placental protein 13-like, Charcot-Leyden crystal protein 2, Recombinant Human Galectin-14 protein(N-His)
Supplier: Elabscience
Supplier-Nr: E-PKSH034189

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
MW: 16.92 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: +4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Galectin-14 protein(N-His) (recombinant human)"
Write a review
or to review a product.
Viewed