9 products were found matching "GeneID 5288"!

No results were found for the filter!
Anti-PIK3C2G
Anti-PIK3C2G

Item number: G-PACO07210.50

PIK3C2G Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. PIK3C2G Antibody is a high quality polyclonal antibody for research use only.. Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol...
Keywords: Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
225.00€ *
Review
Anti-PIK3C2G
Anti-PIK3C2G

Item number: CSB-PA782930.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
From 126.00€ *
Review
Anti-PIK3C2G
Anti-PIK3C2G

Item number: ATA-HPA077589.100

Polyclonal Antibody against Human PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Validated applications: ICC, Uniprot ID: O75747, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Generates...
Keywords: Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
PIK3C2G (human), recombinant protein
PIK3C2G (human), recombinant protein

Item number: ABS-PP-5858-L.100

Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. [The UniProt Consortium]
Keywords: Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma,...
Expressed in: E.coli
Origin: human
MW: 11.5 kD
From 115.00€ *
Review
PIK3C2G, Human phosphoinositide-3-kinase, class 2, gamma polypeptide, Real Time PCR Primer Set
PIK3C2G, Human phosphoinositide-3-kinase, class 2, gamma...

Item number: VHPS-6888

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: PIK3C2G, EC=2.7.1.154, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma, Phosphoinositide 3-kinase-C2-gamma,...
Application: RNA quantification
45.00€ *
Review
Anti-PI3KC2G, NT (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma, Phos
Anti-PI3KC2G, NT (Phosphatidylinositol-4-phosphate...

Item number: P4186-23F.200

PI3KC2G belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2...
Keywords: EC=2.7.1.154, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing...
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
Anti-PI 3-Kinase C2gamma
Anti-PI 3-Kinase C2gamma

Item number: ELK-ES8365.100

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain...
Keywords: Anti-PIK3C2G, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide 3-kinase-C2-gamma,...
Application: WB, IHC
Host: Rabbit
Species reactivity: human, rat, mouse,
From 173.00€ *
Review
PIK3C2G (human), recombinant protein
PIK3C2G (human), recombinant protein

Item number: ABS-PP-5858.100

Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. [The UniProt Consortium]
Keywords: Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma,...
Expressed in: E.coli
Origin: human
MW: 11.5 kD
From 90.00€ *
Review
PIK3C2G PrEST Antigen
PIK3C2G PrEST Antigen

Item number: ATA-APrEST95607.100

PrEST Antigen PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Antigen sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: PIK3C2G, EC=2.7.1.154, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma, Phosphoinositide 3-kinase-C2-gamma,...
Expressed in: E.coli
Origin: human
264.00€ *
Review