Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ATA-APrEST95607.100 | 100 µl |
7 - 10 business days* |
264.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
PrEST Antigen PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic... more
Product information "PIK3C2G PrEST Antigen"
PrEST Antigen PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Antigen sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. [The UniProt Consortium] Mouse gene identity: 47% Rat gene identity: 47%
| Keywords: | PIK3C2G, EC=2.7.1.154, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma, Phosphoinositide 3-kinase-C2-gamma, Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma |
| Supplier: | Atlas Antibodies |
| Supplier-Nr: | APrEST95607 |
Properties
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | human |
| Format: | Solution |
Database Information
| KEGG ID : | K00923 | Matching products |
| UniProt ID : | O75747 | Matching products |
| Gene ID : | GeneID 5288 | Matching products |
Handling & Safety
| Storage: | -20°C (avoid repeat freezing and thawing cycles) |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed