14 products were found matching "GeneID 100339322"!
No results were found for the filter!
IL-17A (rabbit) Do-It-Yourself ELISA
Item number: DIY0963U-003
The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
| Keywords: | IL17A |
| Application: | ELISA |
| Species reactivity: | rabbit |
From 1,098.00€
*
Anti-IL-17A (rabbit)
Item number: KP0961U-100
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Keywords: | IL17A |
| Application: | WB, ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
549.00€
*
Anti-IL-17A (rabbit), Biotin conjugated
Item number: KPB0962U-050
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Keywords: | IL17A |
| Application: | WB, ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
549.00€
*
Interleukin 17A (IL17A), partial, rabbit, recombinant
Item number: CSB-EP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH HMA....
| Keywords: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | rabbit |
| MW: | 42.3 kD |
From 364.00€
*
Interleukin 17A (IL17A), partial, rabbit, recombinant
Item number: CSB-YP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: Yeast. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH...
| Keywords: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | rabbit |
| MW: | 17.3 kD |
From 407.00€
*
IL-17 Protein, Rabbit, Recombinant (His)
Item number: TGM-TMPY-04609-100ug
Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 17.3 kD |
677.00€
*
IL-17 Protein, Rabbit, Recombinant
Item number: TGM-TMPY-04888-100ug
Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 15.1 kD |
748.00€
*
NEW
IL-17 Protein, Rabbit, Recombinant (His)
Item number: TGM-TMPY-04609-10ug
Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 17.3 kD |
From 65.00€
*
NEW
IL-17 Protein, Rabbit, Recombinant
Item number: TGM-TMPY-04888-10ug
Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 15.1 kD |
From 73.00€
*
Rabbit Interleukin 17, IL-17 ELISA Kit
Item number: CSB-E08058Rb.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 31.25 pg/mL-2000 pg/mL Sensitivity: 7.81 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nm
| Keywords: | Interleukin 17A |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | rabbit |
From 421.00€
*
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A...
Item number: 373794.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
| Keywords: | Interleukin 17A |
| MW: | 17,3 |
From 707.00€
*
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag...
Item number: 373779.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
| Keywords: | Interleukin 17A |
| MW: | 42,3 |
From 786.00€
*