- Search results for GeneID 100339322
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "GeneID 100339322"!
Close filters
Filter by:
No results were found for the filter!
Item number: DIY0963U-003
The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
| Keywords: | IL17A |
| Application: | ELISA |
| Species reactivity: | rabbit |
From 1,098.00€
*
Item number: KPB0962U-050
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Keywords: | IL17A |
| Application: | WB, ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
549.00€
*
Item number: CSB-EP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH HMA....
| Keywords: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | rabbit |
| MW: | 42.3 kD |
From 364.00€
*
Item number: CSB-YP011597RB.1
Organism: Oryctolagus cuniculus (Rabbit). Source: Yeast. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH...
| Keywords: | Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | rabbit |
| MW: | 17.3 kD |
From 407.00€
*
Item number: TGM-TMPY-04609-100ug
Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 17.3 kD |
677.00€
*
Item number: TGM-TMPY-04888-100ug
Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 15.1 kD |
748.00€
*
Item number: TGM-TMPY-04609-10ug
Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 17.3 kD |
From 65.00€
*
Item number: TGM-TMPY-04888-10ug
Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
| Keywords: | interleukin 17A |
| MW: | 15.1 kD |
From 73.00€
*
Item number: CSB-E08058Rb.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 31.25 pg/mL-2000 pg/mL Sensitivity: 7.81 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nm
| Keywords: | Interleukin 17A |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | rabbit |
From 421.00€
*
Item number: 373794.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
| Keywords: | Interleukin 17A |
| MW: | 17,3 |
From 707.00€
*
Item number: 373779.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
| Keywords: | Interleukin 17A |
| MW: | 42,3 |
From 786.00€
*
Item number: KP0961U-020
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Keywords: | IL17A |
| Application: | WB, ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
From 274.00€
*