ZBTB8B PrEST Antigen

ZBTB8B PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95606.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative... more
Product information "ZBTB8B PrEST Antigen"
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Mouse gene identity: 76% Rat gene identity: 76%
Keywords: ZBTB8B, Zinc finger and BTB domain-containing protein 8B
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95606

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZBTB8B PrEST Antigen"
Write a review
or to review a product.
Viewed