8 products were found matching "Q8NAP8"!

No results were found for the filter!
Anti-ZBTB8B
Anti-ZBTB8B

Item number: ATA-HPA055553.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 88%
Keywords: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Application: IHC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Anti-ZBTB8B
Anti-ZBTB8B

Item number: ATA-HPA071427.100

Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Keywords: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-ZBTB8B
Anti-ZBTB8B

Item number: ATA-HPA071427.25

Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Keywords: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
Anti-ZBTB8B, CT (ZBTB8B, Zinc finger and BTB domain-containing protein 8B)
Anti-ZBTB8B, CT (ZBTB8B, Zinc finger and BTB...

Item number: 044011.200

ZBTB8B may be involved in transcriptional regulation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
Keywords: Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
ZBTB8B PrEST Antigen
ZBTB8B PrEST Antigen

Item number: ATA-APrEST89159.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: ZBTB8B, Zinc finger and BTB domain-containing protein 8B
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
ZBTB8B (human), recombinant protein
ZBTB8B (human), recombinant protein

Item number: ABS-PP-3613.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Keywords: Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein
Expressed in: E.coli
Origin: human
MW: 11.5 kD
From 90.00€ *
Review
ZBTB8B PrEST Antigen
ZBTB8B PrEST Antigen

Item number: ATA-APrEST95606.100

PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: ZBTB8B, Zinc finger and BTB domain-containing protein 8B
Expressed in: E.coli
Origin: human
264.00€ *
Review
ZBTB8B (human), recombinant protein
ZBTB8B (human), recombinant protein

Item number: ABS-PP-3613-L.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Keywords: Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein
Expressed in: E.coli
Origin: human
MW: 11.5 kD
From 115.00€ *
Review