7 products were found matching "Q8NAP8"!
No results were found for the filter!
Anti-ZBTB8B
Item number: ATA-HPA055553.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 88%
| Keywords: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-ZBTB8B
Item number: ATA-HPA071427.100
Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
ZBTB8B (human), recombinant protein
Item number: ABS-PP-3613-L.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 11.5 kD |
From 115.00€
*
Anti-ZBTB8B, CT (ZBTB8B, Zinc finger and BTB...
Item number: 044011.200
ZBTB8B may be involved in transcriptional regulation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Keywords: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
ZBTB8B PrEST Antigen
Item number: ATA-APrEST89159.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ZBTB8B, Zinc finger and BTB domain-containing protein 8B |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZBTB8B (human), recombinant protein
Item number: ABS-PP-3613.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 11.5 kD |
From 90.00€
*
ZBTB8B PrEST Antigen
Item number: ATA-APrEST95606.100
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | ZBTB8B, Zinc finger and BTB domain-containing protein 8B |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*