TMCO5A PrEST Antigen

TMCO5A PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95787.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative... more
Product information "TMCO5A PrEST Antigen"
PrEST Antigen TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Antigen sequence: EETKVKLQQLEASYACQEKELLKVMKEYAFVTQLCEDQALYIKKYQETLKKIEEELEALFLEREVSKLVSMNPVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 71% Rat gene identity: 71%
Keywords: TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95787

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q8N6Q1 | Matching products
Gene ID : GeneID 145942 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "TMCO5A PrEST Antigen"
Write a review
or to review a product.
Viewed