12 products were found matching "Q8N6Q1"!
No results were found for the filter!
Anti-TMCO5A
Item number: G-PACO39098.50
TMCO5A Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB, IHC, IF applications. TMCO5A Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Anti-TMCO5A
Item number: ATA-HPA056530.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 86% and to rat: 89%
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-TMCO5A
Item number: ATA-HPA064017.100
Polyclonal Antibody against Human TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Validated applications: ICC, Uniprot ID: Q8N6Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 71% Rat gene...
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
TMCO5A (human), recombinant protein
Item number: ABS-PP-4525-L.100
| Keywords: | Transmembrane and coiled-coil domain-containing protein 5A, Recombinant Human TMCO5A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27.5 kD |
From 115.00€
*
TMCO5A PrEST Antigen
Item number: ATA-APrEST85678.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
TMCO5A (Vector Vector will be determined during the...
Item number: CSB-CL843283HU.10
Length: 867 Sequence: atggaaatct caagattggc tcagtcaaaa agaaacatta tcagtttgaa catggacctt gaaagggata cgcagagaat agatgaagca aaccagaaac ttcttctcaa aatccaagag agggaagata agattcagag gctggaaagt gagatcattc agacgcgggg cctggtggaa gatgaagagt gggagaagga gaaccgcacc acgatggaaa gggaaagagc cttgcaggag ctggaggaag aaacagccag...
| Keywords: | TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-TMCO5A
Item number: CSB-PA843283LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TMCO5A, HRP conjugated
Item number: CSB-PA843283LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TMCO5A, FITC conjugated
Item number: CSB-PA843283LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TMCO5A, Biotin conjugated
Item number: CSB-PA843283LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
TMCO5A (human), recombinant protein
Item number: ABS-PP-4525.100
| Keywords: | Transmembrane and coiled-coil domain-containing protein 5A, Recombinant Human TMCO5A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27.5 kD |
From 90.00€
*
TMCO5A PrEST Antigen
Item number: ATA-APrEST95787.100
PrEST Antigen TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Antigen sequence: EETKVKLQQLEASYACQEKELLKVMKEYAFVTQLCEDQALYIKKYQETLKKIEEELEALFLEREVSKLVSMNPVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 71%...
| Keywords: | TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*