11 products were found matching "Q9UKZ4"!
No results were found for the filter!
Anti-TENM1 / Teneurin 1
Item number: NSJ-FY12691
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. TENM1 antibody detects Teneurin 1, a large type II transmembrane protein involved in neuronal connectivity, axon guidance, and cell-cell adhesion. Encoded by the TENM1 gene on chromosome Xq25, Teneurin 1 belongs to the teneurin family of...
| Keywords: | Anti-TENM1, Anti-Teneurin-1, Anti-Tenascin-M1, Anti-Protein Odd Oz/ten-m homolog 1, Anti-Teneurin transmembrane protein 1,... |
| Application: | IHC, IF, FC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
790.00€
*
Anti-TENM1
Item number: ATA-HPA002848.100
Protein function: Involved in neural development, regulating the establishment of proper connectivity within the nervous system. May function as a cellular signal transducer. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity...
| Keywords: | Anti-ODZ1, Anti-TENM1 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-TENM1
Item number: ATA-HPA063910.100
Polyclonal Antibody against Human TENM1, Gene description: teneurin transmembrane protein 1, Alternative Gene Names: ODZ1, ODZ3, TEN-M1, TEN1, TNM, Validated applications: ICC, Uniprot ID: Q9UKZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in...
| Keywords: | Anti-ODZ1, Anti-TENM1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-Teneurin-1 (Ten-1, Tenascin-M1, Ten-m1, Protein Odd...
Item number: T2550-20E.100
Teneurin-1(also Ten-m1, tenascin-M1, and Ten-m/Odz1) is a 250-300kD member of the tenascin family, teneurin subfamily of transmembrane (TM) molecules. It is a covalently-linked homodimer that is expressed in both embryonic and adult neurons, among which are cerebellar granule cells and CA2 pyramidal hippocampal...
| Application: | ELISA, WB |
| Host: | Sheep |
| Species reactivity: | human |
1,025.00€
*
TENM1 PrEST Antigen
Item number: ATA-APrEST74331.100
Protein function: Involved in neural development, regulating the establishment of proper connectivity within the nervous system. May function as a cellular signal transducer. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ODZ1, TENM1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-TENM1
Item number: G-CAB15774.20
Protein function: Involved in neural development, regulating the establishment of proper connectivity within the nervous system. May function as a cellular signal transducer. [The UniProt Consortium]
| Keywords: | Anti-ODZ1, Anti-TENM1 |
| Application: | WB, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
Anti-TENM1, Biotin conjugated
Item number: CSB-PA892339LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: TENM1. Antigen Species: Human
| Keywords: | Anti-ODZ1, Anti-TENM1, TENM1 antibody, ODZ1 antibody, TNM1 antibody, Teneurin-1 antibody, Ten-1 antibody, Protein Odd... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TENM1
Item number: CSB-PA892339LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: TENM1. Antigen Species: Human
| Keywords: | Anti-ODZ1, Anti-TENM1, TENM1 antibody, ODZ1 antibody, TNM1 antibody, Teneurin-1 antibody, Ten-1 antibody, Protein Odd... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TENM1, HRP conjugated
Item number: CSB-PA892339LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: TENM1. Antigen Species: Human
| Keywords: | Anti-ODZ1, Anti-TENM1, TENM1 antibody, ODZ1 antibody, TNM1 antibody, Teneurin-1 antibody, Ten-1 antibody, Protein Odd... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TENM1, FITC conjugated
Item number: CSB-PA892339LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: TENM1. Antigen Species: Human
| Keywords: | Anti-ODZ1, Anti-TENM1, TENM1 antibody, ODZ1 antibody, TNM1 antibody, Teneurin-1 antibody, Ten-1 antibody, Protein Odd... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
TENM1 PrEST Antigen
Item number: ATA-APrEST95960.100
PrEST Antigen TENM1, Gene description: teneurin transmembrane protein 1, Alternative Gene Names: ODZ1, ODZ3, TEN-M1, TEN1, TNM, Antigen sequence: DGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | ODZ1, TENM1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*