STAU2 PrEST Antigen

STAU2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95800.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative... more
Product information "STAU2 PrEST Antigen"
PrEST Antigen STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Antigen sequence: CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%
Keywords: STAU2, Double-stranded RNA-binding protein Staufen homolog 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95800

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "STAU2 PrEST Antigen"
Write a review
or to review a product.
Viewed