- Search results for Q9NUL3
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "Q9NUL3"!
Close filters
Filter by:
No results were found for the filter!
Item number: E-AB-18765.120
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Keywords: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 89.00€
*
Item number: E-AB-52678.120
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Keywords: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 89.00€
*
Item number: ATA-HPA075293.100
Polyclonal Antibody against Human STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Validated applications: IHC, WB, Uniprot ID: Q9NUL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: RNA-binding protein...
| Keywords: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-9586-L.100
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Keywords: | Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 28 kD |
From 115.00€
*
Item number: G-CAB3413.20
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Keywords: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2 |
| Application: | WB, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
Item number: ELK-ES12908.100
Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
| Keywords: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
Item number: CSB-CL885729HU1.10
Length: 318 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
| Keywords: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-CL885729HU2.10
Length: 1617 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
| Keywords: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
Item number: CSB-PA022819GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
| Keywords: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Item number: CSB-PA885729ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
| Keywords: | Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ABS-PP-9586.100
Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
| Keywords: | Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 28 kD |
From 90.00€
*
Item number: ATA-APrEST95800.100
PrEST Antigen STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Antigen sequence: CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding...
| Keywords: | STAU2, Double-stranded RNA-binding protein Staufen homolog 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*