12 products were found matching "Q9NUL3"!

No results were found for the filter!
Anti-STAU2
Anti-STAU2

Item number: E-AB-18765.120

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
Keywords: Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody
Application: IHC, ELISA
Host: Rabbit
Species reactivity: human, mouse, rat
From 89.00€ *
Review
Anti-STAU2
Anti-STAU2

Item number: E-AB-52678.120

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
Keywords: Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 Polyclonal Antibody
Application: IHC, ELISA
Host: Rabbit
Species reactivity: human, mouse, rat
From 89.00€ *
Review
Anti-STAU2
Anti-STAU2

Item number: ATA-HPA075293.100

Polyclonal Antibody against Human STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Validated applications: IHC, WB, Uniprot ID: Q9NUL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: RNA-binding protein...
Keywords: Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2
Application: IHC, WB
Host: Rabbit
Species reactivity: human
491.00€ *
Review
STAU2 (human), recombinant protein
STAU2 (human), recombinant protein

Item number: ABS-PP-9586-L.100

Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
Keywords: Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein
Expressed in: E.coli
Origin: human
MW: 28 kD
From 115.00€ *
Review
Anti-STAU2
Anti-STAU2

Item number: G-CAB3413.20

Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
Keywords: Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2
Application: WB, IF
Host: Rabbit
Species reactivity: human, mouse, rat
103.00€ *
Review
Anti-STAU2
Anti-STAU2

Item number: ELK-ES12908.100

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind...
Keywords: Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, STAU2 rabbit pAb
Application: WB
Host: Rabbit
Species reactivity: human, mouse, rat
From 173.00€ *
Review
STAU2 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
STAU2 (Vector Vector will be determined during the...

Item number: CSB-CL885729HU1.10

Length: 318 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
Keywords: STAU2, Double-stranded RNA-binding protein Staufen homolog 2
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
STAU2 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
STAU2 (Vector Vector will be determined during the...

Item number: CSB-CL885729HU2.10

Length: 1617 Sequence: atgcttcaaa taaatcagat gttctcagtg cagctgagtc ttggtgagca gacatgggaa tccgaaggca gcagtataaa gaaggctcag caggctgttg ccaataaagc tttgactgaa tctacgcttc ccaaaccagt tcagaagcca cccaaaagta atgttaacaa taacccaggc agtataactc caactgtgga actgaatggg cttgctatga aaaggggaga gcctgccatc tacaggccat tagatccaaa...
Keywords: STAU2, Double-stranded RNA-binding protein Staufen homolog 2
Application: Molecular biology, clone
Species reactivity: human
357.00€ *
Review
Anti-STAU2
Anti-STAU2

Item number: CSB-PA022819GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
Keywords: Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
552.00€ *
Review
Anti-STAU2
Anti-STAU2

Item number: CSB-PA885729ESR2HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: STAU2. Antigen Species: Human
Keywords: Anti-STAU2, Anti-Double-stranded RNA-binding protein Staufen homolog 2, 39K2 antibody, 39K3 antibody, DKFZp781K0371...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
STAU2 (human), recombinant protein
STAU2 (human), recombinant protein

Item number: ABS-PP-9586.100

Protein function: RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from...
Keywords: Double-stranded RNA-binding protein Staufen homolog 2, Recombinant Human STAU2 Protein
Expressed in: E.coli
Origin: human
MW: 28 kD
From 90.00€ *
Review
STAU2 PrEST Antigen
STAU2 PrEST Antigen

Item number: ATA-APrEST95800.100

PrEST Antigen STAU2, Gene description: staufen double-stranded RNA binding protein 2, Alternative Gene Names: 39K2, Antigen sequence: CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding...
Keywords: STAU2, Double-stranded RNA-binding protein Staufen homolog 2
Expressed in: E.coli
Origin: human
264.00€ *
Review