SHOC1 PrEST Antigen

SHOC1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95882.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84,... more
Product information "SHOC1 PrEST Antigen"
PrEST Antigen SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Antigen sequence: LTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence of single-stranded DNA (PubMed:29742103). Plays a key role in homologous recombination and crossing-over in meiotic prophase I in male and female germ cells. Requiref for recruitment TEX11 and MSH4 to recombination intermediates. [The UniProt Consortium] Mouse gene identity: 57% Rat gene identity: 57%
Keywords: MZIP2, Protein ZIP2 homolog, Protein shortage in chiasmata 1 ortholog
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95882

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q5VXU9 | Matching products
Gene ID : GeneID 158401 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "SHOC1 PrEST Antigen"
Write a review
or to review a product.
Viewed