4 products were found matching "Q5VXU9"!

No results were found for the filter!

Item number: ATA-HPA052214.100

Polyclonal Antibody against Human SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Validated applications: ICC, Uniprot ID: Q5VXU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: ATPase required...

Keywords:	Anti-MZIP2, Anti-Protein ZIP2 homolog, Anti-Protein shortage in chiasmata 1 ortholog
Application:	ICC
Host:	Rabbit
Species reactivity:	human

491.00€ *

Show details

Review

SHOC1 (human), recombinant protein

Item number: ABS-PP-7130-L.100

Protein function: ATPase required during meiosis for the formation of crossover recombination intermediates. Binds DNA: preferentially binds to single-stranded DNA and DNA branched structures (PubMed:29742103). Does not show nuclease activity in vitro, but shows ATPase activity, which is stimulated by the presence...

Keywords:	Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein
Expressed in:	E.coli
Origin:	human
MW:	18.5 kD

From 115.00€ *

Show details

Review

SHOC1 (human), recombinant protein

Item number: ABS-PP-7130.100

Keywords:	Protein shortage in chiasmata 1 ortholog, Protein ZIP2 homolog, MZIP2, Recombinant Human SHOC1 Protein
Expressed in:	E.coli
Origin:	human
MW:	18.5 kD

From 90.00€ *

Show details

Review

SHOC1 PrEST Antigen

Item number: ATA-APrEST95882.100

PrEST Antigen SHOC1, Gene description: shortage in chiasmata 1, Alternative Gene Names: C9orf84, FLJ32779, MZIP2, Zip2, Antigen sequence: LTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: ATPase...

Keywords:	MZIP2, Protein ZIP2 homolog, Protein shortage in chiasmata 1 ortholog
Expressed in:	E.coli
Origin:	human

264.00€ *

Show details

Review

Didn't find the right Product? Here are some useful Search Tips!

Checklist-Thumbnail

All our products have English titles and descriptions. Therefore, use English search terms.
Write out Greek letters - i.e. "alpha" instead of α or "beta" instead of β.
Do not add "and" when entering multiple search terms.
Use the singular (e.g. "antibody" instead of "antibodies").
If available, try synonyms (e.g. for a specific protein).
You can search for chemical substances using the unique CAS number (Chemical Abstracts Service).
In addition, you can also use the UniProt or KEGG accession number for the product search.
Use our filter function to narrow down your search results. If you want to remove a selected filter again, click on the small "x" next to the filter.
Are you looking for products from a specific supplier? Then enter the corresponding supplier name and select it in the appearing suggestion field. Alternatively, you can also use our supplier overview.
Use - if known - the specific product number. Especially for short numbers, note the supplier code in front of each number for most of our partners (e.g. for AAT Bioquest "ABD-121" instead of just "121"). Click on the button below to find all supplier codes and additional information.

All Supplier Codes

We would be very happy to support you in your product search! Contact us at info@biomol.com.