SHLD2 PrEST Antigen

SHLD2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95845.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names:... more
Product information "SHLD2 PrEST Antigen"
PrEST Antigen SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Antigen sequence: ISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end resection (PubMed:29656893, PubMed:29789392). Mediates various NHEJ-dependent processes including immunoglobulin class-switch recombination, and fusion of unprotected telomeres (PubMed:29656893). [The UniProt Consortium] Mouse gene identity: 49% Rat gene identity: 49%
Keywords: Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95845

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q86V20 | Matching products
Gene ID : GeneID 54537 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "SHLD2 PrEST Antigen"
Write a review
or to review a product.
Viewed