8 products were found matching "Q86V20"!

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...

Polyclonal Antibody against Human SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Validated applications: IHC, Uniprot ID: Q86V20, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...

Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...

Length: 2508 Sequence: atgagtggag gatctcaagt ccacattttt tggggtgctc caattgctcc actgaaaatc acagtatcag aagacacagc ttctttaatg tctgttgctg acccctggaa aaaaattcag cttttataca gtcaacattc tttatatctg aaggatgaaa aacagcacaa aaatcttgaa aactataaag tcccagaatc tattggttct ccagatctta gtggtcattt cttagcaaac tgtatgaata gacatgttca...

Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...

PrEST Antigen SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Antigen sequence: ISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...