RBM46 PrEST Antigen

RBM46 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95630.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names:... more
Product information "RBM46 PrEST Antigen"
PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Antigen sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
Keywords: CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95630

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q8TBY0 | Matching products
Gene ID : GeneID 166863 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RBM46 PrEST Antigen"
Write a review
or to review a product.
Viewed