11 products were found matching "Q8TBY0"!
No results were found for the filter!
NEW
RBM46 Protein, Human, Recombinant (His)
Item number: TGM-TMPH-04580-100ug
Description: RBM46 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TBY0.
| Keywords: | RNA-binding motif protein 46 , Probable RNA-binding protein 46 , RBM46 , Cancer/testis antigen 68 (CT68) |
| MW: | 66.9 kD |
From 93.00€
*
Anti-RBM46
Item number: ATA-HPA038431.100
Polyclonal Antibody against Human RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Validated applications: ICC, Uniprot ID: Q8TBY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 90% Rat gene identity: 90%
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-RBM46
Item number: ATA-HPA037746.100
Polyclonal Antibody against Human RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Validated applications: ICC, Uniprot ID: Q8TBY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Probable RNA-binding protein 46 (RBM46), recombinant human
Item number: CSB-EP851536HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-533aa. Protein Length: Full Length. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: MNEENIDGTN GCSKVRTGIQ NEAALLALME KTGYNMVQEN GQRKFGGPPP GWEGPPPPRG CEVFVGKIPR DMYEDELVPV FERAGKIYEF RLMMEFSGEN RGYAFVMYTT KEEAQLAIRI LNNYEIRPGK...
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 66.9 kD |
From 247.00€
*
RBM46 (human), recombinant protein
Item number: ABS-PQ-3807-L.100
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 64 kD |
From 295.00€
*
RBM46 (human), recombinant protein
Item number: ABS-PQ-3807.100
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 64 kD |
From 270.00€
*
RBM46 PrEST Antigen
Item number: ATA-APrEST79790.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-RBM46
Item number: ATA-HPA079488.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-RBM46
Item number: G-CAB16605.20
RBM46 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in WB applications.RBM46 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
RBM46 (Vector Vector will be determined during the...
Item number: CSB-CL851536HU.10
Length: 1602 Sequence: atgaatgaag aaaatataga tggaacaaat ggatgcagta aagttcgaac tggtattcag aatgaagcag cattacttgc tttgatggaa aagactggtt acaacatggt tcaggaaaat ggacaaagga aatttggcgg tcctcctcca ggttgggaag gtccacctcc acctagaggc tgtgaagttt ttgtaggaaa aatacctcgt gatatgtatg aagatgagtt agttcctgta tttgaaagag ctgggaagat...
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
RBM46 PrEST Antigen
Item number: ATA-APrEST95630.100
PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Antigen sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*