- Search results for P48454
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
19 products were found matching "P48454"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA074370.100
Polyclonal Antibody against Human PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Validated applications: ICC, Uniprot ID: P48454, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Keywords: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*
Item number: CSB-EP018574HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-512aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SGRRFHLSTT DRVIKAVPFP PTQRLTFKEV FENGKPKVDV LKNHLVKEGR LEEEVALKII NDGAAILRQE KTMIEVDAPI TVCGDIHGQF FDLMKLFEVG GSPSNTRYLF LGDYVDRGYF SIECVLYLWS LKINHPKTLF...
Keywords: | PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
Application: | Activity not tested |
Expressed in: | E.coli |
Origin: | human |
MW: | 62 kD |
From 219.00€
*
Item number: NSJ-F40087-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Keywords: | Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic... |
Application: | WB, IHC, ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 350.00€
*
Item number: NSJ-F40178-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Keywords: | Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic... |
Application: | IHC, WB, ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 350.00€
*
Item number: ATA-HPA023396.100
Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32....
Keywords: | Anti-CALNA3, Anti-PPP3CC, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Application: | ICC, IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
From 239.00€
*

Item number: ATA-APrEST95711.100
PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent,...
Keywords: | PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-PA018574GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Keywords: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Application: | ELISA, WB |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
552.00€
*

Item number: CSB-PA018574ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Keywords: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Application: | ELISA, WB, IHC |
Host: | Rabbit |
Species reactivity: | human, rat |
From 167.00€
*

Item number: CSB-PA018574ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Keywords: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
Application: | ELISA, WB, IHC |
Host: | Rabbit |
Species reactivity: | human, rat |
From 167.00€
*

Item number: CSB-CL018574HU.10
Length: 1539 Sequence: atgtccggga ggcgcttcca cctctccacc accgaccgcg tcatcaaagc tgtccccttt cctccaaccc aacggcttac tttcaaggaa gtatttgaga atgggaaacc taaagttgat gttttaaaaa accatttggt aaaggaagga cgactggaag aggaagtagc cttaaagata atcaatgatg gggctgccat cctgaggcaa gagaagacta tgatagaagt agatgctcca atcacagtat gtggtgatat...
Keywords: | CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
Application: | Molecular biology, clone |
Species reactivity: | human |
357.00€
*

Item number: VHPS-7178
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | CALNA3, PPP3CC, EC=3.1.3.16, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit,... |
Application: | RNA quantification |
44.00€
*

Item number: 040359.200
Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be...
Keywords: | Anti-PPP3CC, Anti-CALNA3, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic... |
Application: | ELISA, IHC, WB |
Host: | Rabbit |
Species reactivity: | human |
767.00€
*