4 products were found matching "Q5TBK1"!
No results were found for the filter!
Anti-N4BP2L1
Item number: ATA-HPA038971.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 70% and to rat: 69%
| Keywords: | Anti-CG081, Anti-N4BP2L1, Anti-NEDD4-binding protein 2-like 1 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-N4BP2L1
Item number: ATA-HPA057219.100
Polyclonal Antibody against Human N4BP2L1, Gene description: NEDD4 binding protein 2 like 1, Alternative Gene Names: CG018, Validated applications: ICC, Uniprot ID: Q5TBK1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 90% Rat gene identity: 90%
| Keywords: | Anti-CG081, Anti-N4BP2L1, Anti-NEDD4-binding protein 2-like 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
N4BP2L1 PrEST Antigen
Item number: ATA-APrEST81341.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CG081, N4BP2L1, NEDD4-binding protein 2-like 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
N4BP2L1 PrEST Antigen
Item number: ATA-APrEST95951.100
PrEST Antigen N4BP2L1, Gene description: NEDD4 binding protein 2 like 1, Alternative Gene Names: CG018, Antigen sequence: SGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
| Keywords: | CG081, N4BP2L1, NEDD4-binding protein 2-like 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
