Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| 516811.10 | 10 µg | - | - |
5 - 10 business days* |
404.00€
|
||
| 516811.50 | 50 µg | - | - |
5 - 10 business days* |
715.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in... more
Product information "Leukocyte Surface CD47, Recombinant, Human, aa19-139, His-Tag (CD47)"
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. Source: Recombinant partial protein corresponding to aa19-139 of human Leukocyte Surface CD47, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~14.76kD, Biological Activity: The ED50 as determined by its ability to bind human SIRPA in functional ELISA is less than 20ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
| Keywords: | IAP, MER6, CD47, Protein MER6, Integrin-associated protein, Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3 |
| Supplier: | United States Biological |
| Supplier-Nr: | 516811 |
Properties
| Conjugate: | No |
| Host: | Mammalian cells |
| Species reactivity: | human |
| MW: | 14.76 kD |
| Purity: | >=95% (SDS-PAGE) |
| Format: | Lyophilized |
Database Information
| KEGG ID : | K06266 | Matching products |
| UniProt ID : | Q08722 | Matching products |
| Gene ID : | GeneID 961 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed