Leukocyte Surface CD47, Recombinant, Human, aa19-139, FC-Tag (CD47)

Leukocyte Surface CD47, Recombinant, Human, aa19-139, FC-Tag (CD47)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
516810.10 10 µg - -

5 - 10 business days*

587.00€
516810.50 50 µg - -

5 - 10 business days*

1,112.00€
 
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in... more
Product information "Leukocyte Surface CD47, Recombinant, Human, aa19-139, FC-Tag (CD47)"
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. Source: Recombinant partial protein corresponding to aa19-139 of human Leukocyte Surface CD47, fused to Fc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~40.8kD, Biological Activity: The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 200ng/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: IAP, MER6, CD47, Protein MER6, Integrin-associated protein, Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3
Supplier: United States Biological
Supplier-Nr: 516810

Properties

Conjugate: No
Host: Mammalian cells
Species reactivity: human
MW: 40.8 kD
Purity: >=95% (SDS-PAGE)
Format: Lyophilized

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Leukocyte Surface CD47, Recombinant, Human, aa19-139, FC-Tag (CD47)"
Write a review
or to review a product.
Viewed