KMT2C PrEST Antigen

KMT2C PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95694.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR,... more
Product information "KMT2C PrEST Antigen"
PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional coactivation. KMT2C/MLL3 may be a catalytic subunit of this complex. May be involved in leukemogenesis and developmental disorder. [The UniProt Consortium] Mouse gene identity: 67% Rat gene identity: 67%
Keywords: HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C, Myeloid/lymphoid or mixed-lineage leukemia protein 3
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95694

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "KMT2C PrEST Antigen"
Write a review
or to review a product.
Viewed