- Search results for Q8NEZ4
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "Q8NEZ4"!
Close filters
Filter by:
No results were found for the filter!
Item number: BPS-79758
The MLL3 Complex Chemiluminescent Assay Kit is designed to measure MLL3 activity for screening and profiling applications, using purified MLL3 and its complex components: WDR5, RbBP5, Ash2, and DPY30. The key to the MLL3 Complex Chemiluminescent Assay Kit is a highly specific antibody that recognizes methylated K4...
| Keywords: | KMT2C, HALR, MLL3, lysine methyltransferase 2C, KLEFS2, |
| Application: | Enzyme kinetics, HTS |
| Species reactivity: | human |
1,182.00€
*
Item number: ATA-HPA074736.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA062814.100
Polyclonal Antibody against Human KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Validated applications: ICC, WB, Uniprot ID: Q8NEZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Histone...
| Keywords: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Application: | WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: NSJ-F55128-0.05ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. KMT2C (Lysine N-methyltransferase 2C), also called MML3 (Myeloid/lymphoid or mixed-lineage leukemia protein 3) is a histone methyltransferase, which means it adds methyl groups to histone proteins. This modification plays a critical role in controlling how genes are turned...
| Keywords: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 361.00€
*
Item number: ABS-PP-914-L.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31 kD |
From 115.00€
*
Item number: ATA-APrEST93244.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-914.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31 kD |
From 90.00€
*
Item number: ATA-APrEST95694.100
PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*