8 products were found matching "Q8NEZ4"!
No results were found for the filter!
MLL3 Complex Chemiluminescent Assay Kit
Item number: BPS-79758
The MLL3 Complex Chemiluminescent Assay Kit is designed to measure MLL3 activity for screening and profiling applications, using purified MLL3 and its complex components: WDR5, RbBP5, Ash2, and DPY30. The key to the MLL3 Complex Chemiluminescent Assay Kit is a highly specific antibody that recognizes methylated K4...
| Keywords: | KMT2C, HALR, MLL3, lysine methyltransferase 2C, KLEFS2, |
| Application: | Enzyme kinetics, HTS |
| Species reactivity: | human |
1,182.00€
*
Anti-KMT2C
Item number: ATA-HPA074736.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-KMT2C
Item number: ATA-HPA062814.100
Polyclonal Antibody against Human KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Validated applications: ICC, WB, Uniprot ID: Q8NEZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Histone...
| Keywords: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Application: | WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-MLL3 / KMT2C, clone 1686CT202.60.69
Item number: NSJ-F55128-0.05ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. KMT2C (Lysine N-methyltransferase 2C), also called MML3 (Myeloid/lymphoid or mixed-lineage leukemia protein 3) is a histone methyltransferase, which means it adds methyl groups to histone proteins. This modification plays a critical role in controlling how genes are turned...
| Keywords: | Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 361.00€
*
KMT2C (human), recombinant protein
Item number: ABS-PP-914-L.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31 kD |
From 115.00€
*
KMT2C PrEST Antigen
Item number: ATA-APrEST93244.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
KMT2C (human), recombinant protein
Item number: ABS-PP-914.100
Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
| Keywords: | Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31 kD |
From 90.00€
*
KMT2C PrEST Antigen
Item number: ATA-APrEST95694.100
PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*