HLA-DOA PrEST Antigen

HLA-DOA PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95717.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha,... more
Product information "HLA-DOA PrEST Antigen"
PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM. [The UniProt Consortium] Mouse gene identity: 86% Rat gene identity: 86%
Keywords: HLA-DOA, HLA-DNA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha chain
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95717

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "HLA-DOA PrEST Antigen"
Write a review
or to review a product.
Viewed