GPX2 PrEST Antigen

GPX2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96064.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen GPX2, Gene description: glutathione peroxidase 2, Alternative Gene Names: GSHPX-GI,... more
Product information "GPX2 PrEST Antigen"
PrEST Antigen GPX2, Gene description: glutathione peroxidase 2, Alternative Gene Names: GSHPX-GI, Antigen sequence: MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. [The UniProt Consortium] Mouse gene identity: 89% Rat gene identity: 89%
Keywords: GPX2, GPx-2, GPRP-2, GPx-GI, GSHPx-2, GSHPx-GI, EC=1.11.1.9, Glutathione peroxidase 2, Glutathione peroxidase-gastrointestinal, Gastrointestinal glutathione peroxidase, Glutathione peroxidase-related protein 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96064

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "GPX2 PrEST Antigen"
Write a review
or to review a product.
Viewed