22 products were found matching "P18283"!
No results were found for the filter!
Anti-GPX2
Item number: ATA-HPA075070.100
Polyclonal Antibody against Human GPX2, Gene description: glutathione peroxidase 2, Alternative Gene Names: GSHPX-GI, Validated applications: ICC, Uniprot ID: P18283, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Could play a major role in protecting...
| Keywords: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
Anti-Glutathione peroxidase 2, Internal
Item number: ARG63800.100
Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. [The UniProt Consortium]
| Keywords: | Anti-GPX2, Anti-GPx-2, Anti-GPx-GI, Anti-GPRP-2, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Application: | ELISA, WB |
| Host: | Goat |
| Species reactivity: | human |
822.00€
*
Human Glutathione Peroxidase 2 / GPX2 ELISA Kit
Item number: G-HUFI01311.96
| Application: | ELISA |
| Species reactivity: | human |
641.00€
*
Anti-Glutathione peroxidase 2
Item number: NSJ-R35954-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: GPX2, GI-GPx, GSHPX-GI Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and...
| Keywords: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Application: | WB, ELISA (peptide) |
| Host: | Goat |
| Species reactivity: | human |
790.00€
*
Anti-GPX2
Item number: ARG59621.100
Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. [The UniProt Consortium]
| Keywords: | Anti-GPX2, Anti-GPx-2, Anti-GPx-GI, Anti-GPRP-2, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
658.00€
*
Anti-GPX2
Item number: E-AB-66645.120
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in...
| Keywords: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 243.00€
*
Anti-GPX2
Item number: ATA-HPA003545.100
Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. [The UniProt Consortium] Buffer: 40% glycerol and PBS...
| Keywords: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 239.00€
*
GPX2 (human, recombinant)
Item number: Cay39630-100
Glutathione peroxidase 2 (GPX2) is a selenocysteine-containing glutathione peroxidase that protects cells from oxidative damage. It is a homotetramer and has an active site containing selenocysteine, glutamine, asparagine, and tryptophan. mRNA encoding GPX2 has been found predominantly in the liver and...
| Keywords: | GPX2, GPx-2, GPx-GI, GPRP-2, GSHPx-2, GSHPx-GI, EC=1.11.1.9, Glutathione peroxidase 2, Glutathione... |
| Application: | Active enzyme |
| Expressed in: | E.coli |
| Origin: | human |
From 557.00€
*
Human GPX2 (Glutathione Peroxidase 2, Gastrointestinal)...
Item number: ELK-ELK4705.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GPX2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GPX2. Next,...
| Keywords: | GPx-2, GPx-GI, GPRP-2, GSHPx-2, GSHPx-GI, Glutathione peroxidase 2, Gastrointestinal glutathione peroxidase, Glutathione... |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
GPX2 (human), recombinant protein
Item number: ABS-PP-4014.100
| Keywords: | Glutathione peroxidase 2, GPx-2, GSHPx-2, Gastrointestinal glutathione peroxidase, Glutathione... |
| MW: | 23 kD |
From 90.00€
*
GPX2 PrEST Antigen
Item number: ATA-APrEST96064.100
PrEST Antigen GPX2, Gene description: glutathione peroxidase 2, Alternative Gene Names: GSHPX-GI, Antigen sequence: MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Could play a major role in protecting mammals from the toxicity of...
| Keywords: | GPX2, GPx-2, GPRP-2, GPx-GI, GSHPx-2, GSHPx-GI, EC=1.11.1.9, Glutathione peroxidase 2, Glutathione... |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
Anti-GPX2, Biotin conjugated
Item number: CSB-PA009867LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: GPX2. Antigen Species: Human
| Keywords: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*