FN3KRP PrEST Antigen

FN3KRP PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95687.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen FN3KRP, Gene description: fructosamine 3 kinase related protein, Alternative Gene... more
Product information "FN3KRP PrEST Antigen"
PrEST Antigen FN3KRP, Gene description: fructosamine 3 kinase related protein, Alternative Gene Names: FLJ12171, FN3KL, Antigen sequence: GRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and psicoselysine-3 phosphate adducts are unstable and decompose under physiological conditions (PubMed:14633848, PubMed:15137908). Not able to phosphorylate fructoselysine (PubMed:14633848). [The UniProt Consortium] Mouse gene identity: 93% Rat gene identity: 93%
Keywords: FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related protein
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95687

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "FN3KRP PrEST Antigen"
Write a review
or to review a product.
Viewed