14 products were found matching "K15523"!
No results were found for the filter!
Anti-FN3KRP
Item number: E-AB-18182.120
A high concentration of glucose can result in non-enzymatic oxidation of proteins by reaction of glucose and lysine residues (glycation). Proteins modified in this way are less active or functional. This gene encodes an enzyme which catalyzes the phosphorylation of psicosamines and ribulosamines compared to the...
| Keywords: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Application: | IHC, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 89.00€
*
Anti-FN3KRP
Item number: ATA-HPA056172.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Keywords: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-FN3KRP
Item number: ATA-HPA065831.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Keywords: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-FN3KRP
Item number: ATA-HPA065939.100
Polyclonal Antibody against Human FN3KRP, Gene description: fructosamine 3 kinase related protein, Alternative Gene Names: FLJ12171, FN3KL, Validated applications: ICC, WB, Uniprot ID: Q9HA64, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Application: | WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
FN3KRP (human), recombinant protein
Item number: ABS-PP-8883-L.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Keywords: | Ketosamine-3-kinase, Fructosamine-3-kinase-related protein, FN3K-RP, FN3K-related protein, Protein-psicosamine 3-kinase... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 21.5 kD |
From 115.00€
*
FN3KRP, Recombinant, Human, aa1-309, His-Tag...
Item number: 349919.500
Ketosamine-3-kinase, also known as FN3KRP, catalyzes the phosphorylation of psicosamines and ribulosamines compared to the neighboring gene which encodes a highly similar enzyme, fructosamine-3-kinase, which has different substrate specificity. The activity of both enzymes may result in deglycation of proteins to...
| Keywords: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Origin: | human |
| MW: | 36.8 kD |
From 636.00€
*
FN3KRP PrEST Antigen
Item number: ATA-APrEST88161.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Keywords: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-FN3KRP
Item number: G-CAB15512.20
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Keywords: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
FN3KRP (Vector Vector will be determined during the...
Item number: CSB-CL867182HU.10
Length: 930 Sequence: atggaggagc tgctgaggcg cgagctgggc tgcagctctg tcagggccac gggccactcg gggggcgggt gcatcagcca gggccggagc tacgacacgg atcaaggacg agtgttcgtg aaagtgaacc ccaaggcgga ggccagaaga atgtttgaag gtgagatggc aagtttaact gccatcctga aaacaaacac ggtgaaagtg cccaagccca tcaaggttct ggatgcccca ggcggcggga gcgtgctggt...
| Keywords: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-FN3KRP
Item number: CSB-PA008761GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: FN3KRP. Antigen Species: Human
| Keywords: | Anti-FN3K-RP, Anti-Ketosamine-3-kinase, Anti-FN3K-related protein, Anti-Protein-psicosamine 3-kinase FN3KRP,... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
FN3KRP (human), recombinant protein
Item number: ABS-PP-8883.100
Protein function: Ketosamine-3-kinase involved in protein deglycation by mediating phosphorylation of ribuloselysine and psicoselysine on glycated proteins, to generate ribuloselysine-3 phosphate and psicoselysine-3 phosphate, respectively (PubMed:14633848, PubMed:15137908). Ribuloselysine-3 phosphate and...
| Keywords: | Ketosamine-3-kinase, Fructosamine-3-kinase-related protein, FN3K-RP, FN3K-related protein, Protein-psicosamine 3-kinase... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 21.5 kD |
From 90.00€
*
FN3KRP PrEST Antigen
Item number: ATA-APrEST95687.100
PrEST Antigen FN3KRP, Gene description: fructosamine 3 kinase related protein, Alternative Gene Names: FLJ12171, FN3KL, Antigen sequence: GRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLDA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Ketosamine-3-kinase involved in protein...
| Keywords: | FN3K-RP, Ketosamine-3-kinase, FN3K-related protein, Protein-psicosamine 3-kinase FN3KRP, Fructosamine-3-kinase-related... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*