FAM120C PrEST Antigen

FAM120C PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95866.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene... more
Product information "FAM120C PrEST Antigen"
PrEST Antigen FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Antigen sequence: NWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDHITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 73% Rat gene identity: 73%
Keywords: CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95866

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q9NX05 | Matching products
Gene ID : GeneID 54954 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "FAM120C PrEST Antigen"
Write a review
or to review a product.
Viewed