8 products were found matching "Q9NX05"!
No results were found for the filter!
Anti-FAM120C
Item number: ATA-HPA047677.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 73%
| Keywords: | Anti-CXorf17, Anti-FAM120C, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-FAM120C
Item number: ATA-HPA054250.100
Polyclonal Antibody against Human FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Validated applications: ICC, Uniprot ID: Q9NX05, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 73% Rat...
| Keywords: | Anti-FAM120C, Anti-CXorf17, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
FAM120C (human), recombinant protein
Item number: ABS-PP-2842-L.100
| Keywords: | Constitutive coactivator of PPAR-gamma-like protein 2, Protein FAM120C, Tumor antigen BJ-HCC-21, Recombinant Human FAM120C... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 115.00€
*
FAM120C, Human family with sequence similarity 120C, Real...
Item number: VHPS-3140
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | FAM120C, CXorf17, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Application: | RNA quantification |
45.00€
*
FAM120C PrEST Antigen
Item number: ATA-APrEST84841.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FAM120C (Vector Vector will be determined during the...
Item number: CSB-CL873676HU.10
Length: 399 Sequence: atggaacgcc atgctgggct acttgtcagc gctgtgccag gcttgtgcct atcctggcgg cgacggcctg gagctcgtgg tcatgttccc ggggggcctg ggcaaggacc ggctggccga gtggggccgt cggtgccagg ccgagcggca gacagcgcaa ctgatcgtgg gacacgtggg caacaagggc acccctccac cgcgggcctg gttcctgcca ccggcctgcc tgagccactg cgtgaggcta gcactcatcc...
| Keywords: | CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
FAM120C (human), recombinant protein
Item number: ABS-PP-2842.100
| Keywords: | Constitutive coactivator of PPAR-gamma-like protein 2, Protein FAM120C, Tumor antigen BJ-HCC-21, Recombinant Human FAM120C... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 90.00€
*
FAM120C PrEST Antigen
Item number: ATA-APrEST95866.100
PrEST Antigen FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Antigen sequence: NWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDHITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
| Keywords: | CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*