9 products were found matching "Q9NX05"!

No results were found for the filter!
Anti-FAM120C
Anti-FAM120C

Item number: ATA-HPA047677.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 73%
Keywords: Anti-CXorf17, Anti-FAM120C, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of...
Application: ICC, IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-FAM120C
Anti-FAM120C

Item number: ATA-HPA054250.100

Polyclonal Antibody against Human FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Validated applications: ICC, Uniprot ID: Q9NX05, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 73% Rat...
Keywords: Anti-FAM120C, Anti-CXorf17, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-FAM120C
Anti-FAM120C

Item number: ATA-HPA054250.25

Polyclonal Antibody against Human FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Validated applications: ICC, Uniprot ID: Q9NX05, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 73% Rat...
Keywords: Anti-FAM120C, Anti-CXorf17, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of...
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
FAM120C, Human family with sequence similarity 120C, Real Time PCR Primer Set
FAM120C, Human family with sequence similarity 120C, Real...

Item number: VHPS-3140

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: FAM120C, CXorf17, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2
Application: RNA quantification
45.00€ *
Review
FAM120C PrEST Antigen
FAM120C PrEST Antigen

Item number: ATA-APrEST84841.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
FAM120C (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC
FAM120C (Vector Vector will be determined during the...

Item number: CSB-CL873676HU.10

Length: 399 Sequence: atggaacgcc atgctgggct acttgtcagc gctgtgccag gcttgtgcct atcctggcgg cgacggcctg gagctcgtgg tcatgttccc ggggggcctg ggcaaggacc ggctggccga gtggggccgt cggtgccagg ccgagcggca gacagcgcaa ctgatcgtgg gacacgtggg caacaagggc acccctccac cgcgggcctg gttcctgcca ccggcctgcc tgagccactg cgtgaggcta gcactcatcc...
Keywords: CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
FAM120C (human), recombinant protein
FAM120C (human), recombinant protein

Item number: ABS-PP-2842.100

Keywords: Constitutive coactivator of PPAR-gamma-like protein 2, Protein FAM120C, Tumor antigen BJ-HCC-21, Recombinant Human FAM120C...
Expressed in: E.coli
Origin: human
MW: 18 kD
From 90.00€ *
Review
FAM120C PrEST Antigen
FAM120C PrEST Antigen

Item number: ATA-APrEST95866.100

PrEST Antigen FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Antigen sequence: NWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDHITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
Keywords: CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2
Expressed in: E.coli
Origin: human
264.00€ *
Review
FAM120C (human), recombinant protein
FAM120C (human), recombinant protein

Item number: ABS-PP-2842-L.100

Keywords: Constitutive coactivator of PPAR-gamma-like protein 2, Protein FAM120C, Tumor antigen BJ-HCC-21, Recombinant Human FAM120C...
Expressed in: E.coli
Origin: human
MW: 18 kD
From 115.00€ *
Review